Align 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase (EC 5.3.3.18) (characterized)
to candidate WP_086509213.1 BZY95_RS06815 2,3-dehydroadipyl-CoA hydratase
Query= BRENDA::P77467 (262 letters) >NCBI__GCF_002151265.1:WP_086509213.1 Length = 257 Score = 144 bits (362), Expect = 2e-39 Identities = 88/257 (34%), Positives = 132/257 (51%), Gaps = 6/257 (2%) Query: 5 ILSHVEKGVMTLTLNRPERLNSFNDEMHAQLAECLKQVERDDTIRCLLLTGAGRGFCAGQ 64 I+ +GV+ +TL RPE LN+ + A+LAE L E+D +R +++TG+ R F AG Sbjct: 6 IVEGPSRGVLRITLYRPEALNALTTALLAELAETLVAAEQDAEVRAVVITGSQRAFAAGA 65 Query: 65 DLNDRNVDPTGPAPDLGMSVERFYNPLVRRLAKLPKPVICAVNGVAAGAGATLALGGDIV 124 D+ + A DL +E +A+ KP++ AVNG G G LA+ DI+ Sbjct: 66 DIKEM------AAHDLVGMLEDPRQRHWASIARFSKPIVAAVNGFCLGGGCELAMHADIL 119 Query: 125 IAARSAKFVMAFSKLGLIPDCGGTWLLPRVAGRARAMGLALLGNQLSAEQAHEWGMIWQV 184 IA ++F LG++P GGT L R G+A A + L G +SA +A E G+I ++ Sbjct: 120 IAGEDSRFGQPEINLGIMPGAGGTQRLVRAVGKALATQMVLTGEPISAHRALEAGLISEI 179 Query: 185 VDDETLADTAQQLARHLATQPTFGLGLIKQAINSAETNTLDTQLDLERDYQRLAGRSADY 244 E + A +A +A + + L ++A++ AE L T L ER L + D Sbjct: 180 TQPELAVERALAVAETIAAKAPLAVRLAREALHKAEDTDLTTGLRFERHAFTLLAGTRDR 239 Query: 245 REGVSAFLAKRSPQFTG 261 EG+ AF KR FTG Sbjct: 240 EEGIRAFQEKRPATFTG 256 Lambda K H 0.321 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 257 Length adjustment: 24 Effective length of query: 238 Effective length of database: 233 Effective search space: 55454 Effective search space used: 55454 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory