Align Enoyl-CoA hydratase; EC 4.2.1.17 (characterized, see rationale)
to candidate WP_086509213.1 BZY95_RS06815 2,3-dehydroadipyl-CoA hydratase
Query= uniprot:A0A2Z5MCI7 (262 letters) >NCBI__GCF_002151265.1:WP_086509213.1 Length = 257 Score = 130 bits (326), Expect = 4e-35 Identities = 87/265 (32%), Positives = 138/265 (52%), Gaps = 15/265 (5%) Query: 1 MSAELLTSRPTESESTLVLTLSNPGARNALHPDMYAAGIEALDSVERDPSIRAVVITGAD 60 M + L+ P S L +TL P A NAL + A E L + E+D +RAVVITG+ Sbjct: 1 MPSYLIVEGP--SRGVLRITLYRPEALNALTTALLAELAETLVAAEQDAEVRAVVITGSQ 58 Query: 61 NFFCAGGNLNRL----LENRAKDPSVQAQSIDLLAEWISALRLSSKPVIAAVDGAAAGAG 116 F AG ++ + L +DP + W S R S KP++AAV+G G G Sbjct: 59 RAFAAGADIKEMAAHDLVGMLEDPRQR--------HWASIARFS-KPIVAAVNGFCLGGG 109 Query: 117 FSLALACDLIVAADDAKFVMSYARVGLTPDGGGSWFLAQALPRQLATEVLIEGKPIGAAR 176 LA+ D+++A +D++F +G+ P GG+ L +A+ + LAT++++ G+PI A R Sbjct: 110 CELAMHADILIAGEDSRFGQPEINLGIMPGAGGTQRLVRAVGKALATQMVLTGEPISAHR 169 Query: 177 LHELGVVNKLTKPGTARDAAVAWADELGKISPNSVARIKTLVCAAGTQPLSEHLVAERDN 236 E G+++++T+P A + A+A A+ + +P +V + + A L+ L ER Sbjct: 170 ALEAGLISEITQPELAVERALAVAETIAAKAPLAVRLAREALHKAEDTDLTTGLRFERHA 229 Query: 237 FVASLHHREGLEGISAFLEKRAPVY 261 F R+ EGI AF EKR + Sbjct: 230 FTLLAGTRDREEGIRAFQEKRPATF 254 Lambda K H 0.317 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 257 Length adjustment: 24 Effective length of query: 238 Effective length of database: 233 Effective search space: 55454 Effective search space used: 55454 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory