Align 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase (EC 5.3.3.18) (characterized)
to candidate WP_086511176.1 BZY95_RS17490 enoyl-CoA hydratase
Query= BRENDA::Q5SLK3 (254 letters) >NCBI__GCF_002151265.1:WP_086511176.1 Length = 257 Score = 142 bits (358), Expect = 7e-39 Identities = 96/245 (39%), Positives = 135/245 (55%), Gaps = 2/245 (0%) Query: 9 GVLVLTLNRPEKLNAITGELLDALYAALKEGEEDREVRALLLTGAG-RAFSAGQDLTEFG 67 GV+ LT+NRP+ LNA+ +L L A L E E+ ++RALL+TGAG +AF AG D+TE Sbjct: 13 GVVRLTINRPKALNALNSAVLTELEALLTELEKRSDLRALLITGAGEKAFVAGADITEMR 72 Query: 68 DRKPDY-EAHLRRYNRVVEALSGLEKPLVVAVNGVAAGAGMSLALWGDLRLAAVGASFTT 126 + P+ A + R ++ L L P+V VNG G G LAL D +A+ A F Sbjct: 73 TKTPEEARAFASQALRTIKRLETLPVPVVALVNGFCLGGGCELALACDWAVASDNAIFGQ 132 Query: 127 AFVRIGLVPDSGLSFLLPRLVGLAKAQELLLLSPRLSAEEALALGLVHRVVPAEKLMEEA 186 V +G++P G + LPR VG A A +L+ ++ A+EAL +GLV+RV+P +L A Sbjct: 133 PEVLLGVIPGFGGTQRLPRRVGPAMALDLVTTGRKIDAQEALRIGLVNRVMPQAELEAYA 192 Query: 187 LSLAKELAQGPTRAYALTKKLLLETYRLSLTEALALEAVLQGQAGQTQDHEEGVRAFREK 246 L K+LA A K+ + + L ALALE L + +EG+ AF EK Sbjct: 193 EELTKQLAGNGPLAVRSAKQAVHDGMDQDLDSALALETSLFALGFAGSEQKEGMSAFVEK 252 Query: 247 RPPRF 251 R P F Sbjct: 253 RKPNF 257 Lambda K H 0.318 0.135 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 257 Length adjustment: 24 Effective length of query: 230 Effective length of database: 233 Effective search space: 53590 Effective search space used: 53590 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory