Align aldehyde dehydrogenase (NAD+) (EC 1.2.1.3) (characterized)
to candidate WP_086510113.1 BZY95_RS11785 aldehyde dehydrogenase
Query= BRENDA::P05091 (517 letters) >NCBI__GCF_002151265.1:WP_086510113.1 Length = 506 Score = 367 bits (943), Expect = e-106 Identities = 206/481 (42%), Positives = 286/481 (59%), Gaps = 16/481 (3%) Query: 40 FINNEWHDAVSRKTFPTVNPSTGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDAS 99 +I E+ V + F V+P GEV CQ+ ED+DKA+ AA AA W R A+ Sbjct: 22 YIGGEFVPPVKGQYFDNVSPVNGEVFCQIPRSTAEDIDKALDAAHAA---APAWGRTSAT 78 Query: 100 HRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGK 159 R +L ++AD IE++ LA ET DNGK + DL + + RY+AG G Sbjct: 79 ERSNILLKMADRIEQNLEKLAVAETWDNGKAVRETLNADLPLAIDHFRYFAGCIRAQEGT 138 Query: 160 TIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTAL 219 ID + SY HEP+GV GQIIPWNFPLLM WKL PALA GN VV+K AEQTP + L Sbjct: 139 AADIDANTVSYHFHEPLGVVGQIIPWNFPLLMAVWKLAPALAAGNCVVLKPAEQTPASVL 198 Query: 220 YVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNL 279 + L+ + PPGVVN+V G+G AG A+A+ + + K+AFTGST +G I + + N+ Sbjct: 199 ELMKLVGDL-LPPGVVNVVNGYGAEAGQALATSKRIAKIAFTGSTPVGAHI-LKCAADNI 256 Query: 280 KRVTLELGGKSPNIIMSD-ADMDWA-VEQAHFAL---FFNQGQCCCAGSRTFVQEDIYDE 334 T+ELGGKSPNI +D D + A +E+A L FFNQG+ C SR +QEDIYD Sbjct: 257 IPSTVELGGKSPNIYFADIMDAEPAFIEKAAEGLVLAFFNQGEVCTCPSRALIQEDIYDA 316 Query: 335 FVERSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGG-----G 389 F+ + + R GNP D+ + G Q + QF KI+ Y++ ++EGA+ L GG Sbjct: 317 FMAKVMERVGKIKRGNPLDTDVQVGAQASQEQFDKIMSYMDIAREEGAEFLTGGDKESFD 376 Query: 390 IAADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVF 449 A D+GY+IQPT+ + M + +EEIFGPV+ + FK E + AN++ +GL A V+ Sbjct: 377 PAYDKGYYIQPTLLKG-NNKMRVFQEEIFGPVVAVTTFKDEAEALAIANDTEFGLGAGVW 435 Query: 450 TKDLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVT 509 ++D++ A + + +QAG VW NCY + A + FGGYK SG GRE + L+ Y + K + Sbjct: 436 SRDINVAFRMGRGIQAGRVWTNCYHQYPAHAAFGGYKKSGVGRETHKVALEHYQQTKNLL 495 Query: 510 V 510 V Sbjct: 496 V 496 Lambda K H 0.319 0.136 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 660 Number of extensions: 32 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 517 Length of database: 506 Length adjustment: 35 Effective length of query: 482 Effective length of database: 471 Effective search space: 227022 Effective search space used: 227022 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory