Align putrescine transport system permease protein PotH (characterized)
to candidate WP_086510912.1 BZY95_RS16105 ABC transporter permease
Query= CharProtDB::CH_088338 (317 letters) >NCBI__GCF_002151265.1:WP_086510912.1 Length = 295 Score = 164 bits (414), Expect = 3e-45 Identities = 93/282 (32%), Positives = 154/282 (54%), Gaps = 13/282 (4%) Query: 22 QLQMKHGRKL---VIALPYIWLILLFLLPFLIVFKISLAEMARAIPPYTELMEWADGQLS 78 QL+ + G L ++ L IWLI++ LP L + + SL L+ G Sbjct: 4 QLRARFGGPLAMAIVTLLGIWLIVMVTLPQLQMIEYSLRP---------NLLPAQIGGPD 54 Query: 79 ITLNLGNFLQLTDDPLYFDAYLQSLQVAAISTFCCLLIGYPLAWAVAH-SKPSTRNILLL 137 L L N+ L ++ ++ + +++ + + T L + YPLAW +A + P + +L Sbjct: 55 DRLTLANYATLFNNDIHRTIFFKTIWSSVLVTLLTLAVSYPLAWYLAKVATPRQAALCIL 114 Query: 138 LVILPSWTSFLIRVYAWMGILKNNGVLNNFLLWLGVIDQPLTILHTNLAVYIGIVYAYVP 197 L+I+P W + ++R Y+W IL G LN L+ LG+ID+P+ L N V +G+VYAY+ Sbjct: 115 LLIIPFWINEILRTYSWFIILAFRGPLNEVLMMLGLIDRPIRFLSGNGGVMVGMVYAYIL 174 Query: 198 FMVLPIYTALIRIDYSLVEAALDLGARPLKTFFTVIVPLTKGGIIAGSMLVFIPAVGEFV 257 FMV P+Y A+ +D + V AA DLGA ++T +++P K GI G ++ F+ A G + Sbjct: 175 FMVFPVYNAIESLDDNQVRAARDLGAGTVRTHRRIVIPHAKPGIATGCIMTFMLAAGSYA 234 Query: 258 IPELLGGPDSIMIGRVLWQEFFNNRDWPVASAVAIIMLLLLI 299 +P LLG P S ++++ FF +W +A A ++L+L I Sbjct: 235 VPALLGSPGSRWFTQIIYNWFFEGGNWNQGAAYAFLLLVLCI 276 Lambda K H 0.328 0.144 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 262 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 295 Length adjustment: 27 Effective length of query: 290 Effective length of database: 268 Effective search space: 77720 Effective search space used: 77720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory