Align spermidine/putrescine ABC transporter, permease protein PotC (characterized)
to candidate WP_086510913.1 BZY95_RS16110 ABC transporter permease
Query= CharProtDB::CH_088340 (264 letters) >NCBI__GCF_002151265.1:WP_086510913.1 Length = 268 Score = 135 bits (340), Expect = 9e-37 Identities = 78/246 (31%), Positives = 136/246 (55%), Gaps = 3/246 (1%) Query: 10 FMTAIYAYLYIPIIILIVNSFNSSRFGI--NWQGFTTKWYSLLMNNDSLLQAAQHSLTMA 67 ++ + YL++P+II+ +FN SRF W G T +W+ L + + QA ++SL +A Sbjct: 14 YVVIFFIYLFLPLIIMAAATFNDSRFPTVTPWDGTTLRWFGELAADRGMWQALRNSLIVA 73 Query: 68 VFSATFATLIGSLTAVALYRYRFRGKPFVSGMLFVVMMSPDIVMAISLLVLFMLLGIQLG 127 A IG TA+ L R KPF+ ++ +++P +++ IS L+ + G+ G Sbjct: 74 AGVLVVAVPIGIATALFLNTVTSRAKPFLYALILSPLLTPGVIIGISTLIFWRQFGVSGG 133 Query: 128 FWSLLFSHITFCLPFVVVTVYSRLKGFDVRMLEAAKDLGASEFTILRKIILPLAMPAVAA 187 + + TF +V++ V +RL+ FD M AA DLGAS++ + R+I+LP PA+ + Sbjct: 134 IFLTVLGQATFIAAYVMLMVTARLQRFDRTMERAALDLGASQWQMFRRILLPYLKPALYS 193 Query: 188 GWVLSFTLSMDDVVVSSFVTGPSYEILPLKIYSMVKVGVSPEVNALATILLVLSLVMVIA 247 V++F S ++ + FV G L + I S V+ G++P VNAL IL++++++ Sbjct: 194 AAVIAFLQSFENYNTTLFVVGYD-TTLTVYIASKVRTGLTPAVNALGLILILVTVLFAAI 252 Query: 248 SQLIAR 253 +L R Sbjct: 253 YELKRR 258 Lambda K H 0.329 0.141 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 268 Length adjustment: 25 Effective length of query: 239 Effective length of database: 243 Effective search space: 58077 Effective search space used: 58077 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory