Align L-rhamnonate dehydratase; RhamD; EC 4.2.1.90 (characterized)
to candidate WP_086510675.1 BZY95_RS14785 mandelate racemase/muconate lactonizing enzyme family protein
Query= SwissProt::Q8ZNF9 (405 letters) >NCBI__GCF_002151265.1:WP_086510675.1 Length = 378 Score = 115 bits (288), Expect = 2e-30 Identities = 89/296 (30%), Positives = 138/296 (46%), Gaps = 43/296 (14%) Query: 128 GSGGLVMNTISCVDLALWDLFGKVVGLPVYKLLGGAVRDEIQFYATGA--------RPDL 179 G GL + +S +D+ALWD+ GK G+P+ LLGG RD ++ YATG+ D Sbjct: 89 GQRGLTVTALSGIDIALWDIKGKRFGVPISTLLGGRFRDSVRAYATGSFRRAGVDRVEDN 148 Query: 180 AKEM------GFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKCGPDFWLMLDCWMSQDV 233 A+E+ GF K+ + G+ +D ++ +RE GPD LM+D D Sbjct: 149 AREVAGYRREGFHAVKIKIGF-------GVDEDLRVIEAVRESIGPDMRLMIDANHGYDY 201 Query: 234 NYATKLAHACAPFNLKWIEECLPPQQYEGYRELKRNAPAGMMVTSGE-HHGTLQSFRTLA 292 A ++ A F + W EE + P+ YR ++ + P + V GE HG LA Sbjct: 202 LEAVEVGRRAAKFGIDWFEEPVLPEHVSAYRAVRADQP--IPVAGGETWHGRYAMHEPLA 259 Query: 293 ETGIDIMQPDVGWCGGLTTLVEIAALAKSRGQLVVPHGSSVYSHHAVITFTNTPFSEFLM 352 +DI+QPD+ GG T + +A +A G +VPH AV + F L+ Sbjct: 260 TRAVDIIQPDICGVGGFTEIRRVADMAALHGVRLVPHVWGT----AVCLAASLQFMAALL 315 Query: 353 TSPDCSTLRPQFDPIL----LDEP-------VPV-NGRIHKSVLDKPGFGVELNRD 396 +P R +PIL + P P+ + R ++ D PG G+E++R+ Sbjct: 316 PNP---PRRDPIEPILEFDRTENPFRQAVVTTPIEHDRGVVAIPDGPGLGIEIDRE 368 Lambda K H 0.321 0.138 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 389 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 405 Length of database: 378 Length adjustment: 31 Effective length of query: 374 Effective length of database: 347 Effective search space: 129778 Effective search space used: 129778 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory