Align NAD+-dependent L-lactaldehyde dehydrogenase (EC 1.2.1.22) (characterized)
to candidate WP_086510804.1 BZY95_RS15485 NAD-dependent succinate-semialdehyde dehydrogenase
Query= metacyc::MONOMER-16246 (477 letters) >NCBI__GCF_002151265.1:WP_086510804.1 Length = 481 Score = 333 bits (855), Expect = 6e-96 Identities = 187/465 (40%), Positives = 268/465 (57%), Gaps = 3/465 (0%) Query: 11 YIDGAFVESAAHLEVFNPANGALLSRVPAASAEEVERALAAARAAQKDWARKPAIERAGH 70 +I G + ++ +V NPANG L+ VP SA++ A+AAA AA W R+ A +RA Sbjct: 13 FIGGQWRDAERRFDVTNPANGETLASVPDLSADDARDAVAAAEAAWPAWRRQTAKQRAAL 72 Query: 71 LRRIAAKIRADAGRIARTITLEQGKIASLAEVEVNFTADYLDYMAEWARRLEGEIIASDR 130 LR I A +AR +TLEQGK + + EV + A ++++ AE A+R+ GE + S Sbjct: 73 LRAWFDAIMAHQESLARMMTLEQGKPLAESRGEVAYGASFVEFYAEQAKRMAGETLPSHG 132 Query: 131 PGENIFLFRKPLGVVAGILPWNFPFFLIARKMAPALLTGNTIVVKPSEETPNNCFEFARL 190 + I +FR+P+GVVA I PWNFP +I RK APAL G +V+KP+E TP ARL Sbjct: 133 ADKRILVFREPVGVVAAITPWNFPLAMITRKCAPALAAGCPVVIKPAEATPLTALALARL 192 Query: 191 VAETDLPRGVFNVVCGA--GQVGGALSSHPGVDLISFTGSVETGARIMAAAAPNLTKLNL 248 + P GV NVV + ++G L+S P V +SFTGS G R++A A + K ++ Sbjct: 193 AEQVGFPAGVLNVVTASRPAEIGEVLTSDPRVRKVSFTGSTAVGKRLLAQCAGTVKKASM 252 Query: 249 ELGGKAPAIVLADADLELAVKAIRDSRIINSGQVCNCAERVYVQRQVAEPFIERIAAAMA 308 ELGG AP IV DADL+ AV+ S+ NSGQ C C R+ VQ V E F+E++AA +A Sbjct: 253 ELGGNAPFIVFDDADLDAAVEGAVASKYRNSGQTCVCTNRLLVQSGVYEAFVEKLAARVA 312 Query: 309 ATRYGDPLAEPEVEMGPLINRLGLEKIDAKVRTALAQGATLVTGGAIAERPGHHYQPTVL 368 + G+ L E V+ GPLIN+ ++K+ + + ALA+GA LV GG G +QPTV+ Sbjct: 313 QLKVGNGLDEGVVQ-GPLINQAAVDKVQSHIADALAKGARLVCGGEPHALGGTFFQPTVV 371 Query: 369 TGCRADTRIMREEIFGPVLPIQIVDDLDEAIALANDCEYGLTSSVFTRDLNKAMHALREL 428 + R+ REE FGP+ P+ D ++AIA+AN E+GL + + RD + H + L Sbjct: 372 ADVTDEMRVAREETFGPLAPVFRFDSDEQAIAMANATEFGLAAYFYARDYRRIWHVMEGL 431 Query: 429 DFGETYINREHFEAMQGFHAGVRKSGIGGADGKHGLYEYTHTHVV 473 ++G +N GV++SG+G HGL E+T V Sbjct: 432 EYGMVAVNEGILSTELAPFGGVKESGLGREGSHHGLDEFTELKYV 476 Lambda K H 0.320 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 541 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 477 Length of database: 481 Length adjustment: 34 Effective length of query: 443 Effective length of database: 447 Effective search space: 198021 Effective search space used: 198021 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory