Align ABC transporter for D-Sorbitol, permease component 1 (characterized)
to candidate WP_086508159.1 BZY95_RS01105 maltose ABC transporter permease MalG
Query= reanno::BFirm:BPHYT_RS16105 (291 letters) >NCBI__GCF_002151265.1:WP_086508159.1 Length = 296 Score = 97.4 bits (241), Expect = 3e-25 Identities = 65/210 (30%), Positives = 106/210 (50%), Gaps = 6/210 (2%) Query: 88 WNSILISAGVTILCLILAVPAAYAMAFFPTRRTQKVLLWMLSTKMMPSVGVLVPIYLLWK 147 WNS+ ++ ++L ++L+ +AYA A +L ML +M P+V LV +Y L+ Sbjct: 86 WNSVKVAIVSSLLIVLLSTTSAYAFARMRFAGKGPILKSMLIFQMFPAVLSLVALYALFD 145 Query: 148 NSG-----LLDSVSGLVIVYTLINLPIAVWMSFTYFAEIPRDILEAGRIDGAATWQEIVY 202 G L + G +IV +L + + +W YF I + EA +DGA+TWQ Y Sbjct: 146 RLGQFVGWLGINTHGALIVASLGAVALHIWTIKGYFESIDGSLEEAAMVDGASTWQAFRY 205 Query: 203 LLMPMSLPGLASTALLLVILSWNE-AFWSINLSSSNAAPLTVFIASYSSPEGLFWAKLSA 261 +L+P+SLP L +L ++S E S+ L + L V Y + W +A Sbjct: 206 ILLPLSLPILMVVFILAFVMSIMEYPMASVLLVDEHKLTLAVGAQQYLADHNQRWGNFAA 265 Query: 262 ASLLAVAPILIVGWLSQKQLVRGLTFGAVK 291 A++L+ PI + + Q+ ++ GLT G VK Sbjct: 266 AAVLSGLPITLAFLICQRWIIGGLTAGGVK 295 Lambda K H 0.326 0.136 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 248 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 291 Length of database: 296 Length adjustment: 26 Effective length of query: 265 Effective length of database: 270 Effective search space: 71550 Effective search space used: 71550 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory