Align ABC transporter for D-Sorbitol, permease component 1 (characterized)
to candidate WP_086510095.1 BZY95_RS11670 carbohydrate ABC transporter permease
Query= reanno::BFirm:BPHYT_RS16105 (291 letters) >NCBI__GCF_002151265.1:WP_086510095.1 Length = 280 Score = 146 bits (369), Expect = 4e-40 Identities = 81/271 (29%), Positives = 148/271 (54%), Gaps = 5/271 (1%) Query: 25 AIRRGIPGVIAWLVALLLFFPIFWMTITAFKTEQQAYASSLFFI-PTLDSFREVFARSNY 83 A R G ++A L+ ++ FP ++ T+F + L+ TL ++ ++F++ ++ Sbjct: 10 AARAGFWLLVA-LIVVVAVFPFYYAIKTSFTPSGDLFRVELWPTRATLANYAQIFSQRSF 68 Query: 84 FSFAWNSILISAGVTILCLILAVPAAYAMAFFPTRRTQKVLLWMLSTKMMPSVGVLVPIY 143 +NSIL++ V + L+L + A+YA+ R VLL +L M P V VL ++ Sbjct: 69 LQAIFNSILVATSVVFIALLLGITASYALGRVRFRGRTSVLLIILGVSMFPQVAVLSGLF 128 Query: 144 LLWKNSGLLDSVSGLVIVYTLINLPIAVWMSFTYFAEIPRDILEAGRIDGAATWQEIVYL 203 + + L ++ GL++ YT+ LP VW+ T+ ++P ++ EA +DGA W I + Sbjct: 129 EVIRALNLYNNPGGLILSYTIFTLPFTVWVLTTFMRQLPLELEEAAIMDGATPWVTITKV 188 Query: 204 LMPMSLPGLASTALLLVILSWNEAFWSINLS---SSNAAPLTVFIASYSSPEGLFWAKLS 260 +P+ P +A+T LL I +WNE +++ + S P+ + + S S L WA + Sbjct: 189 FLPLMWPAMATTGLLAFIAAWNEFLFALTFTLTDSQRTVPVAIALLSGGSAYELPWAPIM 248 Query: 261 AASLLAVAPILIVGWLSQKQLVRGLTFGAVK 291 AAS++ P++++ + Q+++V GLT GAVK Sbjct: 249 AASVVVTVPLVVLVIIFQRRIVSGLTAGAVK 279 Lambda K H 0.326 0.136 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 269 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 291 Length of database: 280 Length adjustment: 26 Effective length of query: 265 Effective length of database: 254 Effective search space: 67310 Effective search space used: 67310 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory