Align ABC transporter for D-sorbitol, ATPase component (characterized)
to candidate WP_086511129.1 BZY95_RS17245 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::pseudo6_N2E2:Pf6N2E2_1960 (365 letters) >NCBI__GCF_002151265.1:WP_086511129.1 Length = 380 Score = 401 bits (1030), Expect = e-116 Identities = 217/363 (59%), Positives = 263/363 (72%), Gaps = 6/363 (1%) Query: 1 MATLKIENLKKGFEGLSIIKGIDLEVKDKEFVVFVGPSGCGKSTLLRLIAGLEDVTSGTI 60 MATL++ ++ K F+ +IKG+DLEV D+EFVVFVGPSGCGKSTLLR+IAGLE TSG I Sbjct: 1 MATLQLHDIVKRFDDTEVIKGVDLEVNDREFVVFVGPSGCGKSTLLRMIAGLESATSGDI 60 Query: 61 ELDGRDITEVTPAKRDLAMVFQTYALYPHMTVRKNLSFALDLAGEKKPDVERKVAEAARI 120 +DG + EV PA+R LAMVFQ+YALYPHMTV N+ F+L LAG K + RKV EAA I Sbjct: 61 LIDGVRMNEVGPAERGLAMVFQSYALYPHMTVEDNMGFSLKLAGVPKEERRRKVREAASI 120 Query: 121 LELGSLLDRKPKQLSGGQRQRVAIGRAIVRNPKIFLFDEPLSNLDAALRVQTRLELSRLH 180 L+L LL+RKPK LSGGQRQRVAIGRAIVRNP IFLFDEPLSNLDAALRVQ R+EL+RLH Sbjct: 121 LQLEPLLERKPKALSGGQRQRVAIGRAIVRNPSIFLFDEPLSNLDAALRVQMRIELARLH 180 Query: 181 KELQATMIYVTHDQVEAMTLATKVVVLNAGRIEQIGSPLELYHHPANLFVAGFLGTPKMG 240 +EL ATMIYVTHDQ+EAMT+A K+VVL G +EQ+GSP+ELYHHP N FVAGF+G+PKM Sbjct: 181 EELDATMIYVTHDQIEAMTMADKIVVLQGGVVEQVGSPMELYHHPRNRFVAGFIGSPKMN 240 Query: 241 FLQATVHAVHASGVEVRFASGTTLLIPRDSSALSVGQSVTIGIRPEHLTLSAEGQVPVTT 300 FL+ + A+GVEVR G T +P D S L ++T+GIRPEHL L +G + Sbjct: 241 FLEVERVSAAATGVEVRLPDGDTCTVPVDGSGLD-DDALTLGIRPEHLQLDPQGPLSGRI 299 Query: 301 DVTERLGSDTFCHVNVDSGESLTVRVQG--DCEVPYAARRYLTLDVAHCHLFDESGLSVS 358 +V ERLG T +V + + +TV G D V + R D A HLFD GL++ Sbjct: 300 EVIERLGGVTSLYVRMQN-TLVTVSADGNVDSRVGDSLRFGFERDCA--HLFDGEGLALP 356 Query: 359 PAA 361 A Sbjct: 357 SLA 359 Lambda K H 0.319 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 419 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 380 Length adjustment: 30 Effective length of query: 335 Effective length of database: 350 Effective search space: 117250 Effective search space used: 117250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory