Align Sorbitol dehydrogenase (EC 1.1.1.14) (characterized)
to candidate WP_086508062.1 BZY95_RS00580 3-hydroxybutyrate dehydrogenase
Query= reanno::Phaeo:GFF1301 (257 letters) >NCBI__GCF_002151265.1:WP_086508062.1 Length = 260 Score = 134 bits (336), Expect = 2e-36 Identities = 77/187 (41%), Positives = 108/187 (57%), Gaps = 3/187 (1%) Query: 3 RLSGKRALITGAARGIGAAFAEAYANEGARVVIADIDTARAEATAAQI---GAAAIAVEL 59 +L K ALITGAA GIG A AE YA EGARV +AD+D A AEAT AQI G A+A+ + Sbjct: 2 QLIDKTALITGAAGGIGRAIAERYAREGARVAVADLDLAAAEATVAQIRASGGQAMALAM 61 Query: 60 DVTDQASIDRALSRTVECFGGLDILINNAAVFTAAPLVEVTREAYQRTFDINVSGTLFMM 119 DVTD+A++D + R V +G LDI I NA + APL ++ +++ +++ G + Sbjct: 62 DVTDEAAVDAGVERIVAEWGRLDIAIANAGIQHIAPLHSLSFADWRKVLAVHLDGAFLVT 121 Query: 120 QAAAQQMITQGTGGKIINMASQAGRRGEPLVSVYCATKAAVISLTQSAGLNLISHGINVN 179 AA +QM Q +GG +I M S + PL + Y A K ++ L ++ H + N Sbjct: 122 SAALRQMYRQESGGCLIYMGSVHSKLASPLKAPYVAAKHGLLGLCRTVAKEGAKHRVRAN 181 Query: 180 AIAPGVV 186 I PG V Sbjct: 182 MICPGFV 188 Lambda K H 0.317 0.130 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 116 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 260 Length adjustment: 24 Effective length of query: 233 Effective length of database: 236 Effective search space: 54988 Effective search space used: 54988 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory