Align High-affinity branched-chain amino acid transport system permease protein BraD, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_086510662.1 BZY95_RS14710 branched-chain amino acid ABC transporter permease
Query= TCDB::P21627 (307 letters) >NCBI__GCF_002151265.1:WP_086510662.1 Length = 295 Score = 148 bits (374), Expect = 1e-40 Identities = 97/298 (32%), Positives = 156/298 (52%), Gaps = 17/298 (5%) Query: 8 LQQLVNGLTVGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYIAFIAITLLAMMGLDS 67 L QL+ G+ GS YA++++G +++G++ ++NFAHG +M+G++ AF+ L MGLD Sbjct: 12 LGQLMLGIVNGSFYAVLSLGLAIIFGVLKIVNFAHGAFFMLGAFTAFL---LAQYMGLDY 68 Query: 68 VPLMMLAAFAASIIVTSAFGYSIERVAYRPLRGGNRLIPLISAIGMSIFLQNA--VMLSQ 125 +++A ++ +AFG E + R L G + + L+ + + L+ V Sbjct: 69 WVTLLVAP-----LLVAAFGMVFEFLFLRRLYGLDPIYGLLLTFSLVLVLEGGFRVAFGS 123 Query: 126 DSKEKAIPTLLPGNFVFGESSMNGVVISYMQILIFVVTFLVMFGLTLFISRSRLGRACRA 185 + A P L G ++ +++ + + V LV I R+ LG + RA Sbjct: 124 SGQPFATPEQLRGTI-----NLGFMILPLYRGFVIVSALLVCLATWFVIERTSLGASLRA 178 Query: 186 CAEDLKMTNLLGINSNNIIALTFVIGAALAAVAAVLLGMQYGVINPGIGFLAGIKAFTAA 245 E ++T GIN +I LT+ +G LAA A VL + V NP +G I F Sbjct: 179 ATERSELTQAFGINVPRLITLTYGVGVGLAAFAGVLAAPIFHV-NPSMGSSLVIIIFAVV 237 Query: 246 VLGGIGSIPGAMLGGLLLGVAEAFGADVFGDQYKDVVAFGLLILVLLFRPTGILGRPE 303 V+GG+GSI GA++ GL LGV E F VF ++ + F +++LVLL RP G+ GR E Sbjct: 238 VIGGLGSIMGAIVTGLGLGVVEGF-TRVFYSEFSSTIVFLVMVLVLLLRPAGLFGREE 294 Lambda K H 0.328 0.145 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 300 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 295 Length adjustment: 27 Effective length of query: 280 Effective length of database: 268 Effective search space: 75040 Effective search space used: 75040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory