Align Aminomethyltransferase (EC 2.1.2.10) (characterized)
to candidate WP_086511405.1 BZY95_RS18710 glycine cleavage system aminomethyltransferase T
Query= reanno::pseudo13_GW456_L13:PfGW456L13_1866 (374 letters) >NCBI__GCF_002151265.1:WP_086511405.1 Length = 370 Score = 454 bits (1169), Expect = e-132 Identities = 238/370 (64%), Positives = 282/370 (76%), Gaps = 4/370 (1%) Query: 6 LLKTPLHALHIELGARMVPFAGYDMPVQYPLGVMKEHQHTRDQAGLFDVSHMGQIRLTGA 65 L +TPL+ LH+ELG +MVPFAGY+MPVQ+PLGV KEH+HTR+ GLFDVSHMGQ+ L G Sbjct: 4 LKRTPLYDLHLELGGKMVPFAGYEMPVQFPLGVKKEHEHTRNACGLFDVSHMGQLLLHGP 63 Query: 66 NAAKALETLVPVDIIDLPVGMQRYAMFTNATGGILDDLMVANLGNDELFLVVNAACKDQD 125 N A+ALETLV DI+ LP GMQRYA+FT GGILDDLMVAN G D L+LVVNAACKDQD Sbjct: 64 NPAEALETLVCADIVGLPQGMQRYALFTAQEGGILDDLMVANPG-DHLYLVVNAACKDQD 122 Query: 126 LAHLRKHIGDQCTIEPLFEERALLALQGPAAVTVLARLAPEVAKMTFMQFARVKLLGVDC 185 +A L + D+ +E L +RALLALQGP A V+ R P+ ++ FMQ R +L GV Sbjct: 123 IALLDMGLDDEHRVEVL--DRALLALQGPKAADVMRRHCPQACELVFMQHGRFELAGVPV 180 Query: 186 FVSRSGYTGEDGFEISVPATNAEALARALLAEAEVAAIGLGARDSLRLEAGLCLYGHDMN 245 +VSRSGYTGEDGFEISVPA AEALAR LLAE EV AIGLGARDSLRLEAGLCLYGHD++ Sbjct: 181 WVSRSGYTGEDGFEISVPAEEAEALARRLLAEEEVEAIGLGARDSLRLEAGLCLYGHDID 240 Query: 246 TDTTPIEASLLWAISKPRRADGARAGGFPGAETVFAQQQA-GVSRKRVGLLPQERTPVRE 304 T+TTP+EA L+WAI K RR G R GFPGA+ + Q A RKRVGLL + R PVRE Sbjct: 241 TETTPVEAGLVWAIGKARRHGGERPAGFPGADVILHQVDAKDHRRKRVGLLGEGRAPVRE 300 Query: 305 GAEIVNEAGDIIGSVCSGGFGPTLGGPLAMGYVDSAYIALDTPVWAIVRGKKVPLLVSKM 364 GA++ +E G IG V SGGFGP++G P+AMGYVD + + T V A VRGK++P++VSKM Sbjct: 301 GADLYDENGHHIGRVTSGGFGPSVGMPVAMGYVDVEHAEIGTTVHAEVRGKRLPMVVSKM 360 Query: 365 PFVPQRYYRG 374 PFV YYRG Sbjct: 361 PFVAPGYYRG 370 Lambda K H 0.321 0.138 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 499 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 374 Length of database: 370 Length adjustment: 30 Effective length of query: 344 Effective length of database: 340 Effective search space: 116960 Effective search space used: 116960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_086511405.1 BZY95_RS18710 (glycine cleavage system aminomethyltransferase T)
to HMM TIGR00528 (gcvT: glycine cleavage system T protein (EC 2.1.2.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00528.hmm # target sequence database: /tmp/gapView.12899.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00528 [M=362] Accession: TIGR00528 Description: gcvT: glycine cleavage system T protein Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-105 339.4 0.0 1.3e-105 339.2 0.0 1.0 1 lcl|NCBI__GCF_002151265.1:WP_086511405.1 BZY95_RS18710 glycine cleavage s Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_002151265.1:WP_086511405.1 BZY95_RS18710 glycine cleavage system aminomethyltransferase T # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 339.2 0.0 1.3e-105 1.3e-105 1 360 [. 4 363 .. 4 365 .. 0.94 Alignments for each domain: == domain 1 score: 339.2 bits; conditional E-value: 1.3e-105 TIGR00528 1 lkrtpLydlhtelggklvdfaGwelPvqyk.slieeheavrtkaGlfDvshmgkvelsGskslkfLqrl 68 lkrtpLydlh elggk+v+faG+e+Pvq+ ++++ehe +r++ GlfDvshmg+ l G++ ++L+ l lcl|NCBI__GCF_002151265.1:WP_086511405.1 4 LKRTPLYDLHLELGGKMVPFAGYEMPVQFPlGVKKEHEHTRNACGLFDVSHMGQLLLHGPNPAEALETL 72 69***************************6488************************************ PP TIGR00528 69 lanDvdaLtkGkaqysvllnaqGGvvDDlivykegednrfllvvnaataekDlewlkehleeevtldtl 137 + +D+ L++G +y+ + +GG++DDl+v + g+ ++lvvnaa++++D + l l++e ++ l lcl|NCBI__GCF_002151265.1:WP_086511405.1 73 VCADIVGLPQGMQRYALFTAQEGGILDDLMVANPGDH--LYLVVNAACKDQDIALLDMGLDDEHRVEVL 139 **********************************998..9**********************9999877 PP TIGR00528 138 skeisllalqGPkaktiledlldkaveglkefffvqeaelalkkaliartGytGedGfeiavanekave 206 +llalqGPka+++++ +a e l + ++ + ela+ ++r+GytGedGfei+v+ e+a lcl|NCBI__GCF_002151265.1:WP_086511405.1 140 D--RALLALQGPKAADVMRRHCPQACE-LVFMQHG-RFELAGVPVWVSRSGYTGEDGFEISVPAEEAEA 204 5..58************9988877764.3333333.677888888************************ PP TIGR00528 207 lwkklveaygvkPiGLgarDtLrleagmaLyGqeldeeitPleaglgwvvkker.....kksdfiGrav 270 l+++l+++ v iGLgarD+Lrleag++LyG+++d e+tP+eagl w++ k r + f G +v lcl|NCBI__GCF_002151265.1:WP_086511405.1 205 LARRLLAEEEVEAIGLGARDSLRLEAGLCLYGHDIDTETTPVEAGLVWAIGKARrhggeRPAGFPGADV 273 ***************************************************999788777789****** PP TIGR00528 271 leeqkengtekk.lvGlemlekgiarnelkvlltngekevGivtsGtlsPtLgknialayvdkelekiG 338 + +q + + +++ +vGl + r++ +++ ng +++G vtsG + P +g+ +a++yvd e ++iG lcl|NCBI__GCF_002151265.1:WP_086511405.1 274 ILHQVDAKDHRRkRVGLLGEGRAPVREGADLYDENG-HHIGRVTSGGFGPSVGMPVAMGYVDVEHAEIG 341 ****998877666****999999**********999.******************************** PP TIGR00528 339 tklevevrnklvkikvvkklfv 360 t+++ evr+k +++ v k++fv lcl|NCBI__GCF_002151265.1:WP_086511405.1 342 TTVHAEVRGKRLPMVVSKMPFV 363 *********************8 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (362 nodes) Target sequences: 1 (370 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.34 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory