Align Tryptophan 2,3-dioxygenase (EC 1.13.11.11) (characterized)
to candidate WP_086508296.1 BZY95_RS01805 tryptophan 2,3-dioxygenase
Query= reanno::Cup4G11:RR42_RS15390 (291 letters) >NCBI__GCF_002151265.1:WP_086508296.1 Length = 290 Score = 310 bits (795), Expect = 2e-89 Identities = 154/281 (54%), Positives = 189/281 (67%), Gaps = 2/281 (0%) Query: 11 GAGATETSDASWHDAQMDFAKDMSYGDYLALDQILNAQHPLSPEHNEMLFIVQHQTSELW 70 G + + D S D + MSYGDYL L+ +L+AQ P + EH+EMLFIV HQ SELW Sbjct: 7 GQARSASVDLSQEGVHWD--QPMSYGDYLQLEPLLSAQRPGTAEHDEMLFIVIHQVSELW 64 Query: 71 MKLALHELRAARECVRQDQLPPAFKMLTRVSRIMEQLVQAWNVLATMTPPEYSAMRPYLG 130 +K LHE AA + D+L PAFKMLTRV+RI Q++ AW VL TMTP +Y+ R LG Sbjct: 65 LKQCLHEAHAAAAHIASDRLRPAFKMLTRVARIQAQMINAWEVLVTMTPADYARFRDSLG 124 Query: 131 MSSGFQSFQYREIEFILGNKNAAMLRPHAHQPQHLALLEEALRTPSLYDEAIRLMARRGF 190 SSGFQSFQYRE+EF+LGNKNAAM+ H P+ L E L PSLYD +++L+ARRGF Sbjct: 125 QSSGFQSFQYRELEFLLGNKNAAMIEVHRRHPERYRRLSEVLHAPSLYDISLQLLARRGF 184 Query: 191 AIDAACIERDWTRPAGENASVEAAWLEVYRKPEAHWELYELGEKFVDLEDAFRQWRFRHV 250 A+ + + RDW+ P VE AW ++YR +WELYEL EK VD E F QWRF H+ Sbjct: 185 ALPDSVVARDWSEPYRPCDEVEQAWADIYRDTGRYWELYELAEKLVDTEYHFHQWRFSHL 244 Query: 251 TTVERVIGFKRGTGGTEGVSYLRKMLDVVLFPELWKLRTDL 291 TVER+IG K GTGGT G SYL K LD+ FPELW +RT L Sbjct: 245 KTVERIIGQKPGTGGTGGASYLAKALDLQFFPELWSVRTTL 285 Lambda K H 0.322 0.134 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 338 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 291 Length of database: 290 Length adjustment: 26 Effective length of query: 265 Effective length of database: 264 Effective search space: 69960 Effective search space used: 69960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate WP_086508296.1 BZY95_RS01805 (tryptophan 2,3-dioxygenase)
to HMM TIGR03036 (kynA: tryptophan 2,3-dioxygenase (EC 1.13.11.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03036.hmm # target sequence database: /tmp/gapView.31398.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03036 [M=264] Accession: TIGR03036 Description: trp_2_3_diox: tryptophan 2,3-dioxygenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-124 401.0 0.3 1.3e-124 400.8 0.3 1.0 1 lcl|NCBI__GCF_002151265.1:WP_086508296.1 BZY95_RS01805 tryptophan 2,3-dio Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_002151265.1:WP_086508296.1 BZY95_RS01805 tryptophan 2,3-dioxygenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 400.8 0.3 1.3e-124 1.3e-124 3 264 .] 24 285 .. 22 285 .. 0.99 Alignments for each domain: == domain 1 score: 400.8 bits; conditional E-value: 1.3e-124 TIGR03036 3 sesmsYgdYlkldellsaqkplsedhdemlfivqhqvselwlklilheleaaaralradeleaalkala 71 ++ msYgdYl+l+ llsaq+p + +hdemlfiv+hqvselwlk lhe +aaa+++ +d+l++a+k+l+ lcl|NCBI__GCF_002151265.1:WP_086508296.1 24 DQPMSYGDYLQLEPLLSAQRPGTAEHDEMLFIVIHQVSELWLKQCLHEAHAAAAHIASDRLRPAFKMLT 92 678****************************************************************** PP TIGR03036 72 RvsrileqlveaWdvLatltPaeysefRealgessGfqsyqyReiefllGnknaallkphekdpellae 140 Rv+ri+ q+++aW+vL t+tPa+y++fR++lg+ssGfqs+qyRe+efllGnknaa++++h+++pe +++ lcl|NCBI__GCF_002151265.1:WP_086508296.1 93 RVARIQAQMINAWEVLVTMTPADYARFRDSLGQSSGFQSFQYRELEFLLGNKNAAMIEVHRRHPERYRR 161 ********************************************************************* PP TIGR03036 141 leaaleePslYdevlrllarrGfaipaevlerdvtkpaeaneeveaawlevYrdaekewelyelaeklv 209 l+++l++PslYd +l+llarrGfa+p++v+ rd+++p++ ++eve+aw +Yrd+ ++welyelaeklv lcl|NCBI__GCF_002151265.1:WP_086508296.1 162 LSEVLHAPSLYDISLQLLARRGFALPDSVVARDWSEPYRPCDEVEQAWADIYRDTGRYWELYELAEKLV 230 ********************************************************************* PP TIGR03036 210 DledlfrrWRfrhlttveRiiGfkrGtGGssGvayLkkaldvelfPelwkvRtel 264 D+e +f++WRf hl+tveRiiG k GtGG+ G++yL kald ++fPelw+vRt+l lcl|NCBI__GCF_002151265.1:WP_086508296.1 231 DTEYHFHQWRFSHLKTVERIIGQKPGTGGTGGASYLAKALDLQFFPELWSVRTTL 285 *****************************************************86 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (264 nodes) Target sequences: 1 (290 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.47 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory