Align Kynurenine formamidase; KFA; KFase; Arylformamidase; N-formylkynurenine formamidase; FKF; EC 3.5.1.9 (characterized)
to candidate WP_086508297.1 BZY95_RS01810 arylformamidase
Query= SwissProt::P0C8P4 (218 letters) >NCBI__GCF_002151265.1:WP_086508297.1 Length = 210 Score = 251 bits (641), Expect = 7e-72 Identities = 124/206 (60%), Positives = 143/206 (69%) Query: 12 RIWDISPAVSPATPVWPGDTPFQHDPAWQLDEHCPVNVGRITMSPHTGAHADAPLHYAAD 71 R+ DIS + PVWPGDTPF H+P W LD CPVNV R+T+S HTG HADAP HYAAD Sbjct: 3 RLHDISQPLRADMPVWPGDTPFAHEPTWVLDGQCPVNVSRLTLSTHTGTHADAPSHYAAD 62 Query: 72 GAPIGAVPLDAYLGPCRVIHCIGAAPRVEPQHIAHALAGTPPRVLLRTYAQAPQGKWDSA 131 G I V L YLGPC V+ A PRVEP+++ L RVLLRT+ P +W S Sbjct: 63 GQAIDEVELTPYLGPCVVLDMRHAGPRVEPEYLLPVLPSHVERVLLRTWEHFPHERWRSD 122 Query: 132 FCAVAPETISLLARHGVRLIGIDTPSLDPETSKTMDAHHAVRDHQLAILEGIVLDEVPAG 191 F +APE+I LLA G RLIG+DTPSLDPE + AHH VR H +AILEG+VLD VP G Sbjct: 123 FITIAPESIDLLAERGARLIGVDTPSLDPEVDSRLLAHHRVRHHGMAILEGLVLDAVPPG 182 Query: 192 DYELIALPLRLATLDASPVRAVLREL 217 YELIALPL+LA DASPVRA+LREL Sbjct: 183 HYELIALPLKLAGADASPVRALLREL 208 Lambda K H 0.320 0.137 0.444 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 264 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 218 Length of database: 210 Length adjustment: 22 Effective length of query: 196 Effective length of database: 188 Effective search space: 36848 Effective search space used: 36848 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
Align candidate WP_086508297.1 BZY95_RS01810 (arylformamidase)
to HMM TIGR03035 (kynB: arylformamidase (EC 3.5.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03035.hmm # target sequence database: /tmp/gapView.24339.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03035 [M=206] Accession: TIGR03035 Description: trp_arylform: arylformamidase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-85 272.7 0.0 1.4e-85 272.5 0.0 1.0 1 lcl|NCBI__GCF_002151265.1:WP_086508297.1 BZY95_RS01810 arylformamidase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_002151265.1:WP_086508297.1 BZY95_RS01810 arylformamidase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 272.5 0.0 1.4e-85 1.4e-85 1 206 [] 3 208 .. 3 208 .. 0.99 Alignments for each domain: == domain 1 score: 272.5 bits; conditional E-value: 1.4e-85 TIGR03035 1 rlidisqplnedlatwPGdtpfsqelavsleeegsvnvgritlsvhtGahvdaPlhykndgakigdvel 69 rl disqpl +d+++wPGdtpf +e ++ l+ +++vnv+r+tls+htG+h+daP hy +dg++i +vel lcl|NCBI__GCF_002151265.1:WP_086508297.1 3 RLHDISQPLRADMPVWPGDTPFAHEPTWVLDGQCPVNVSRLTLSTHTGTHADAPSHYAADGQAIDEVEL 71 578****************************************************************** PP TIGR03035 70 dvylGpcrvidclsalekiekealksaleeapervllrtaekakaeafdediaavapdtiellaekGvr 138 ylGpc v+d a +++e+e l l ++ervllrt e+ ++e++ +d+ ++ap++i+llae+G r lcl|NCBI__GCF_002151265.1:WP_086508297.1 72 TPYLGPCVVLDMRHAGPRVEPEYLLPVLPSHVERVLLRTWEHFPHERWRSDFITIAPESIDLLAERGAR 140 ***********99******************************************************** PP TIGR03035 139 liGvdtpsvdPleskeldahhalakhdlailenlvldevaeGdyelialPlklaeldaspvravlral 206 liGvdtps+dP + l ahh++++h++aile+lvld v G yelialPlkla +daspvra+lr+l lcl|NCBI__GCF_002151265.1:WP_086508297.1 141 LIGVDTPSLDPEVDSRLLAHHRVRHHGMAILEGLVLDAVPPGHYELIALPLKLAGADASPVRALLREL 208 ******************************************************************86 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (206 nodes) Target sequences: 1 (210 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 5.53 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory