Align 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27) (characterized)
to candidate WP_086511963.1 BZY95_RS21665 4-hydroxyphenylpyruvate dioxygenase
Query= reanno::psRCH2:GFF3449 (361 letters) >NCBI__GCF_002151265.1:WP_086511963.1 Length = 366 Score = 505 bits (1301), Expect = e-148 Identities = 251/360 (69%), Positives = 292/360 (81%), Gaps = 4/360 (1%) Query: 4 VNKIEQHNPIGTDGFEFVEFTAPNAEGIEQLRTLFTQMGFTETAKHRSKEVWLFQQHDIN 63 V+ I Q NPIGT+GFEFVE++AP+AEGIE+LR LF +MGFTET KHRSK+V+LFQQ ++N Sbjct: 8 VSPISQDNPIGTNGFEFVEYSAPSAEGIEELRALFNRMGFTETRKHRSKQVFLFQQENVN 67 Query: 64 IVLNGSPTGHVHAFAEKHGPSACAMAFRVKNAAQAAAYVESQGAKLVGSHANFGELNIPC 123 VLN P H FA+ HGP ACAMA++V +A QA Y + GA+ V + GE+ IP Sbjct: 68 FVLNAEPDSHAAEFAKVHGPCACAMAWKVADAKQAFEYALAHGAEAVENPVGPGEVGIPA 127 Query: 124 VEGIGGSLLYLVDRYGD---KSIYDVDFEYIEGRTPNDNAVGLMCIDHLTHNVMRGQMDV 180 V GIGGSLLY VD D ++IYD+DFE I GR+PNDN+VGL +DHLTHNV RGQMD Sbjct: 128 VRGIGGSLLYFVDNKVDSEGRTIYDIDFEPIPGRSPNDNSVGLKVLDHLTHNVDRGQMDK 187 Query: 181 WSGFYERIANFREIRYFDIEGKLTGLFSRAMTAPCGKIRIPINESADDKSQIEEFIREYH 240 W+ FY IANFRE RYFDI+GK TGL SRAMTAPCGK+ IPINESADD SQI EF+REY+ Sbjct: 188 WADFYTEIANFRENRYFDIKGKKTGLHSRAMTAPCGKMHIPINESADDSSQIAEFLREYN 247 Query: 241 GEGIQHIALSTDDIYATVRQLRANGVDFMTTPDTYYEKVDTRVAGHGEPTDVLRELNILI 300 GEGIQH+A++TDDIYATVR LRANGV F+TTPDTYYEKVDTRV H E + LREL++LI Sbjct: 248 GEGIQHLAMATDDIYATVRGLRANGVTFLTTPDTYYEKVDTRVPNHEENVEDLRELSLLI 307 Query: 301 DGAPGDDGILLQIFTNTVIGPIFFEIIQRKGNQGFGEGNFKALFESIEEDQLRRGVIKAD 360 DG P D+G+LLQ FT TVIGPIFFEIIQRKGN GFGEGNFKALFESIEEDQ+RRGV+KAD Sbjct: 308 DGGP-DEGVLLQTFTETVIGPIFFEIIQRKGNDGFGEGNFKALFESIEEDQIRRGVLKAD 366 Lambda K H 0.320 0.139 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 548 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 366 Length adjustment: 29 Effective length of query: 332 Effective length of database: 337 Effective search space: 111884 Effective search space used: 111884 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_086511963.1 BZY95_RS21665 (4-hydroxyphenylpyruvate dioxygenase)
to HMM TIGR01263 (hppD: 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01263.hmm # target sequence database: /tmp/gapView.11657.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01263 [M=353] Accession: TIGR01263 Description: 4HPPD: 4-hydroxyphenylpyruvate dioxygenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-125 404.1 0.0 3.9e-125 403.9 0.0 1.0 1 lcl|NCBI__GCF_002151265.1:WP_086511963.1 BZY95_RS21665 4-hydroxyphenylpyr Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_002151265.1:WP_086511963.1 BZY95_RS21665 4-hydroxyphenylpyruvate dioxygenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 403.9 0.0 3.9e-125 3.9e-125 2 353 .] 21 363 .. 20 363 .. 0.96 Alignments for each domain: == domain 1 score: 403.9 bits; conditional E-value: 3.9e-125 TIGR01263 2 gfdfvefavgdak..qaakalveklGfeavaketgsrekastvlrqgeitlvltaelsssseaaaflak 68 gf+fve+ ++ a+ + ++al++++Gf++ k +r+k++ +++q+++++vl+ae+ s+ aa+f++ lcl|NCBI__GCF_002151265.1:WP_086511963.1 21 GFEFVEYSAPSAEgiEELRALFNRMGFTETRK---HRSKQVFLFQQENVNFVLNAEPDSH--AAEFAKV 84 89********99977899*************9...***********************99..******* PP TIGR01263 69 HGdgvkdvafevedveaafeaavergaeavsapeeedekevklaaikgiGdvvltlvereg..ekgsil 135 HG++++++a++v+d+++afe a+++gaeav++p+ +ev ++a++giG+++l++v+ + e +i+ lcl|NCBI__GCF_002151265.1:WP_086511963.1 85 HGPCACAMAWKVADAKQAFEYALAHGAEAVENPVG--PGEVGIPAVRGIGGSLLYFVDNKVdsEGRTIY 151 *********************************97..99******************987633566899 PP TIGR01263 136 pgfeevsekaalkekledvgleaiDHvvgnvergelekvaefyekilgfkeiksfdikteasaLkSkvl 204 ++++e + + ++vgl+ +DH+++nv+rg+++k+a+fy +i +f+e ++fdik++ ++L+S+++ lcl|NCBI__GCF_002151265.1:WP_086511963.1 152 DIDFEPIPGRSPN--DNSVGLKVLDHLTHNVDRGQMDKWADFYTEIANFRENRYFDIKGKKTGLHSRAM 218 9999877765444..489*************************************************** PP TIGR01263 205 asaegkvklplnepaskkkksQIeeyleeyeGaGvQHlAlntedivktveelrargveflkipetYYdn 273 ++++gk+++p+ne s +++sQI e+l+ey+G+G+QHlA+ t+di++tv+ lra+gv fl++p+tYY++ lcl|NCBI__GCF_002151265.1:WP_086511963.1 219 TAPCGKMHIPINE--SADDSSQIAEFLREYNGEGIQHLAMATDDIYATVRGLRANGVTFLTTPDTYYEK 285 *************..89**************************************************** PP TIGR01263 274 lkervkklvkedleelkelkiLvDrd.eeGlLLQiFtkpvvdrgtlFfEiIqRkgakGFGegNfkaLfe 341 ++ rv++ ++e++e+l+el++L+D+ +eG+LLQ Ft++v+ g++FfEiIqRkg++GFGegNfkaLfe lcl|NCBI__GCF_002151265.1:WP_086511963.1 286 VDTRVPN-HEENVEDLRELSLLIDGGpDEGVLLQTFTETVI--GPIFFEIIQRKGNDGFGEGNFKALFE 351 ******7.*****************99**************..************************** PP TIGR01263 342 aiEreqekrgvl 353 +iE++q++rgvl lcl|NCBI__GCF_002151265.1:WP_086511963.1 352 SIEEDQIRRGVL 363 *********985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (353 nodes) Target sequences: 1 (366 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.44 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory