Align fumarylacetoacetate (FAA) hydrolase (EC 3.7.1.2) (characterized)
to candidate WP_086509182.1 BZY95_RS06630 FAA hydrolase family protein
Query= reanno::psRCH2:GFF3447 (327 letters) >NCBI__GCF_002151265.1:WP_086509182.1 Length = 339 Score = 466 bits (1199), Expect = e-136 Identities = 231/336 (68%), Positives = 262/336 (77%), Gaps = 11/336 (3%) Query: 1 MKLATLNQGRDGVLVVVSRDLAQAVKVPQIAATLQAALDDWNYCKPKLEAVYQRLNDGLE 60 MKLATL GRDG L+VVSRDL +AV IAATLQ AL++W+ P+LEA Y LNDG Sbjct: 1 MKLATLKNGRDGKLLVVSRDLTRAVSATDIAATLQQALENWDAVSPRLEARYAELNDGSA 60 Query: 61 EGAFAFDQTACHSPLPRAYHWADGSAYVNHVELVRKARGAEMPESFWHDPLMYQGGADAF 120 EGAF+ DQ HSPLPR+YHWADGSAY+NHV+LVR+ARGAE+PESFW+DPLMYQGG D F Sbjct: 61 EGAFSLDQGQLHSPLPRSYHWADGSAYLNHVKLVRQARGAELPESFWNDPLMYQGGGDKF 120 Query: 121 IPPHSPIRLADEAWGIDLEGELAVITDDVPMGATPAEAASHIQLLMLVNDVSLRNLIPGE 180 + P I E GID EGE+AVITDDVPMG TP +AA HI+L+MLVNDVSLR LIPGE Sbjct: 121 LAPTEEIEAVSEEHGIDFEGEIAVITDDVPMGVTPEQAAGHIKLIMLVNDVSLRGLIPGE 180 Query: 181 LAKGFGFYQSKPSSSFSPVAVTPDELGETWRDGKVHRPLVSHINGELFGQPDAGTDMTFN 240 LAKGFGF+Q+KP+SSFSP+ VTPDELG+ W+ GKVH PL H+NGE FG+P+AG DM F Sbjct: 181 LAKGFGFFQAKPASSFSPICVTPDELGDAWQGGKVHLPLTVHLNGEKFGEPEAGPDMIFG 240 Query: 241 FPTLVAHAARTRPLGAGTIIGSGTVSN-----------YDRSAGSSCLAEKRMLEVVEHG 289 FP LVAHAARTR LGAG IIGSGTVSN D G SCLAE RM+E + HG Sbjct: 241 FPELVAHAARTRYLGAGAIIGSGTVSNPDPDGGPGKPIVDGGVGYSCLAEVRMVEQILHG 300 Query: 290 EAKTPFLKFGDRVRIEMFDAAGQSIFGAIDQQVERY 325 AKTPFL+FGDRVRIEMFD AG SIFGAIDQQV +Y Sbjct: 301 AAKTPFLRFGDRVRIEMFDRAGNSIFGAIDQQVVKY 336 Lambda K H 0.318 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 443 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 327 Length of database: 339 Length adjustment: 28 Effective length of query: 299 Effective length of database: 311 Effective search space: 92989 Effective search space used: 92989 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory