Align fumarylacetoacetase (EC 3.7.1.2) (characterized)
to candidate WP_086510183.1 BZY95_RS12100 FAA hydrolase family protein
Query= BRENDA::A0A076VF18 (308 letters) >NCBI__GCF_002151265.1:WP_086510183.1 Length = 294 Score = 116 bits (291), Expect = 6e-31 Identities = 74/194 (38%), Positives = 100/194 (51%), Gaps = 10/194 (5%) Query: 98 PPVACLFFKASQALAGPGDDIVLPRLAR-DEKNDYEVELCVVLGKDAKDVDEKDAMSFVG 156 P +F KA L GD+I PR A E+ DYE E V++GK + + + DA + Sbjct: 108 PKHPIVFTKAWNTLIAHGDEI--PRHAGVTEQLDYEAEFAVIIGKGGRGIKKADAYDHLW 165 Query: 157 GYCVVNDVSSRGLCAKGGQWGMGKSYDTWCPFGPCLVSPSALGADPHKLTITTHVNGKLA 216 GY + NDV++R L + QW +GKS D CP GP LV+ + D TI VNG+L Sbjct: 166 GYTIANDVTARDLQQRHKQWHLGKSLDGLCPMGPWLVTADEVDRD--TATIKCWVNGELR 223 Query: 217 QKGNTADLVLKIPELIARLSHGTTLQAGSLILTGSPIALGRKAPGDAVEQSPFMKDGDEI 276 Q L+ +P LI LS G L G +ILTG+P+ + G F++ GD + Sbjct: 224 QDARLDQLIFDVPTLIETLSAGIALAPGDVILTGTPVGV-----GIGFTPPRFLQTGDIV 278 Query: 277 RCFVEGCGTLINSV 290 R V G GTL N V Sbjct: 279 RIEVAGLGTLENRV 292 Lambda K H 0.316 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 260 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 294 Length adjustment: 27 Effective length of query: 281 Effective length of database: 267 Effective search space: 75027 Effective search space used: 75027 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory