Align Maleylacetoacetate isomerase; MAAI; EC 5.2.1.2 (uncharacterized)
to candidate WP_086510305.1 BZY95_RS12760 glutathione S-transferase family protein
Query= curated2:Q9X4F7 (213 letters) >NCBI__GCF_002151265.1:WP_086510305.1 Length = 203 Score = 67.8 bits (164), Expect = 1e-16 Identities = 62/204 (30%), Positives = 92/204 (45%), Gaps = 16/204 (7%) Query: 7 LYDYWRSSASYRVRIALNLCGEAYRSVPVDLLAKAHRAPEHLARNPQGLVPVLDI-DGER 65 +Y RS Y++++ ++ G + + VD+LA R PE LA+NP G +P+L++ G Sbjct: 4 VYGDRRSGNCYKIQLLMSHLGIEHEWIDVDILAGDTRRPEFLAKNPNGKIPLLELPSGGY 63 Query: 66 LTQSLAIIEYLAETRDGTGLLPAHPIDRQRVRALSYAVAMDIHPVCNLGVVARVMAG-AG 124 L +S AI++YLA GT LP P+ RV + + P VAR +A G Sbjct: 64 LAESNAILDYLAH---GTAFLPNEPLAMARVLSWQFFEQYSHEPYI---AVARFIAKYLG 117 Query: 125 DGEAARREWMQKFIGEGLAAFERMLDHPATGAFCHGDRPTMADLCLVPQVYNARRWDVDL 184 E R E+ K G G A M A + G+ ++AD+ L + A L Sbjct: 118 LPEERREEYEGKQAG-GYKALNVMEQTLAASPYLAGETLSVADVALYAYTHVAHEGGFSL 176 Query: 185 AACPLLVAIDRRCAGIDAFQRAHP 208 P + A R A AHP Sbjct: 177 VDYPAVQAWLARVA-------AHP 193 Lambda K H 0.324 0.138 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 133 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 213 Length of database: 203 Length adjustment: 21 Effective length of query: 192 Effective length of database: 182 Effective search space: 34944 Effective search space used: 34944 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory