Align 3-hydroxyisobutyryl-CoA hydrolase (EC 3.1.2.4) (characterized)
to candidate WP_086509633.1 BZY95_RS09140 enoyl-CoA hydratase/isomerase family protein
Query= reanno::pseudo1_N1B4:Pf1N1B4_4790 (356 letters) >NCBI__GCF_002151265.1:WP_086509633.1 Length = 384 Score = 252 bits (643), Expect = 1e-71 Identities = 153/357 (42%), Positives = 204/357 (57%), Gaps = 23/357 (6%) Query: 16 IGHLTLNRPAGLNAITLDMVRSLQQQLDAWAQDPQVHAVVLRGAGEKAFCAGGDIRSLYD 75 IG TLN P LNA++LDM R L +L AWA D + AV L G+GEKAFCAGGD+ +LY Sbjct: 19 IGIATLNAPKSLNALSLDMARQLDAKLQAWAVDRSIVAVWLEGSGEKAFCAGGDVVALYR 78 Query: 76 SFKSG--------DTLH-EDFFVEEYALDLAIHHYRKPVLALMDGFVLGGGMGLVQGADL 126 S D+L E +F EY LD IH Y KP+L DG V+GGG+GL+ GA Sbjct: 79 SMTEEGENRGAGRDSLFAETYFTTEYRLDYRIHRYPKPILVWGDGIVMGGGLGLMAGAAR 138 Query: 127 RVVTERSRLAMPEVAIGYFPDVGGSHFLPRVPGELGIYLGVSGVQIRAADALYCGLADWY 186 R+VTE + +AMPE+ IG +PD+G S FL R+P +G YLG++G Q+ A DAL GLAD + Sbjct: 139 RLVTETTLIAMPEITIGLYPDIGASWFLNRMPPGVGAYLGLTGAQLNARDALDLGLADHF 198 Query: 187 LESNKLGTLDEQLDQLQWHETPLKDL----QGLLAKLAVQQLPAAPLAALRPAIDHFFAL 242 + + L E L + +DL QG+L + +Q AP A + P +DH AL Sbjct: 199 VPRERRSELLEALGAADYGTRSRRDLQAGVQGVLDEFEARQ--QAPAAQVWPLLDHVQAL 256 Query: 243 P---DVPSMVEQLRAVTVADSHEWATATADLLESRSPLAMGVTLEMLRRGRHLSLEQCFA 299 D P+ V ++ A D+ W A LE+ SPL+ + ML R RH SL F Sbjct: 257 TAQIDAPAAVRRILADARDDA--WLAANRKRLEAGSPLSAHLVWCMLERHRHTSLADAFR 314 Query: 300 LELHLDRQWFERGDLIEGVRALLIDKDKNPRWSPPTLQALDAGHVASFFTGFDPSWS 356 EL+L Q RGD+ EGVRALLIDKD+NP+W ++ + + + +P WS Sbjct: 315 DELNLSVQCCRRGDVAEGVRALLIDKDRNPKWQHASVDDVPEADLQAL---LEPLWS 368 Lambda K H 0.322 0.138 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 394 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 384 Length adjustment: 30 Effective length of query: 326 Effective length of database: 354 Effective search space: 115404 Effective search space used: 115404 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory