Align Enoyl-CoA hydratase [valine degradation] (EC 4.2.1.17) (characterized)
to candidate WP_086509213.1 BZY95_RS06815 2,3-dehydroadipyl-CoA hydratase
Query= reanno::psRCH2:GFF2389 (257 letters) >NCBI__GCF_002151265.1:WP_086509213.1 Length = 257 Score = 210 bits (535), Expect = 2e-59 Identities = 114/242 (47%), Positives = 154/242 (63%) Query: 14 VALITLNRPQALNALNGQLISELNQALGQLEADPQIGCIVLTGSAKAFAAGADIKEMAEL 73 V ITL RP+ALNAL L++EL + L E D ++ +V+TGS +AFAAGADIKEMA Sbjct: 14 VLRITLYRPEALNALTTALLAELAETLVAAEQDAEVRAVVITGSQRAFAAGADIKEMAAH 73 Query: 74 TYPQIYLDDFFADADRIATRRKPLIAAVAGYALGGGCELALLCDMIFAADNARFGQPEVN 133 + D IA KP++AAV G+ LGGGCELA+ D++ A +++RFGQPE+N Sbjct: 74 DLVGMLEDPRQRHWASIARFSKPIVAAVNGFCLGGGCELAMHADILIAGEDSRFGQPEIN 133 Query: 134 LGVLPGIGGTQRLTRAVGKAKAMDMCLTGRQMDAAEAERAGLVARVFPAESLLEETLKAA 193 LG++PG GGTQRL RAVGKA A M LTG + A A AGL++ + E +E L A Sbjct: 134 LGIMPGAGGTQRLVRAVGKALATQMVLTGEPISAHRALEAGLISEITQPELAVERALAVA 193 Query: 194 RVIAEKSLPATMMIKESVNRAFETTLAEGIRFERRVFHAVFATADQKEGMAAFSEKRKPE 253 IA K+ A + +E++++A +T L G+RFER F + T D++EG+ AF EKR Sbjct: 194 ETIAAKAPLAVRLAREALHKAEDTDLTTGLRFERHAFTLLAGTRDREEGIRAFQEKRPAT 253 Query: 254 FT 255 FT Sbjct: 254 FT 255 Lambda K H 0.321 0.135 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 257 Length adjustment: 24 Effective length of query: 233 Effective length of database: 233 Effective search space: 54289 Effective search space used: 54289 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory