Align NatB, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate WP_086510703.1 BZY95_RS14935 amino acid ABC transporter substrate-binding protein
Query= TCDB::Q8YVY4 (441 letters) >NCBI__GCF_002151265.1:WP_086510703.1 Length = 401 Score = 162 bits (411), Expect = 1e-44 Identities = 120/372 (32%), Positives = 184/372 (49%), Gaps = 21/372 (5%) Query: 56 LKIGSLLPATGDLASIGQQMAAAVPLVVETVNACGGVNGQPVSLVAVDDQT--DPKAGAA 113 +KIG + TG + S+ + L V+ +N GG+ G ++ D T D A + Sbjct: 25 VKIGFIGGFTGPIESLTPPIYDGARLAVQQINEQGGILGGQTLVMPSADTTCSDASAASN 84 Query: 114 GMTKLATVDKVAGVVGSFASSVSTAAVSIAA-QNKVLLISPGSTSPVFTEKAQKGDFNGF 172 ++ + V +VG+ + + AA + AA V+++SP ST+P TE D N Sbjct: 85 AADRMVNTENVTAIVGALCTGATVAAANSAAIPGGVVMVSPASTAPAVTEL----DDNDL 140 Query: 173 WARTVPPDSYQGPALAELANKKGFKRVSTIVINNDYGVGFEKAFVQAFEKLGGTVVNKNN 232 RTVP D+YQG LA+L KGF V+ +NNDYG G AF AFE GG V Sbjct: 141 VFRTVPSDAYQGEILAKLMLDKGFDEVAVTYVNNDYGRGLADAFTAAFEAGGGMVAEN-- 198 Query: 233 PVRYDPKATTFETEAAAAFAGKPDAVLGVFYVE-TGSLLLKSAYQQGVAQGVQIMLTDGM 291 + ++ + +E + A + ++ + Y + +G +L+ AY+ G Q DGM Sbjct: 199 -LAHEDGRADYRSELGSLSASGAETLVVLAYADGSGQTILRQAYESGAF--TQFAGADGM 255 Query: 292 KSDEFPAQVGKTADGKFIASGIIGTVPGS-DGKGLEALTKLWQSKKGSAPGEFAPQAWDA 350 VG AD + G+I T PGS + G E + ++ FA QA+DA Sbjct: 256 VGSSLIEAVG--AD---VLEGMIATRPGSPELPGTEIFAEAAEAADLDPTAVFAAQAYDA 310 Query: 351 TALLVLAAQAAKENTGVGIAGKIRDVSSAPGVEVT--DVCEGLKLLQEGKDINYQGASGN 408 LL LA + G++ +R VSSAPG + + + ++L+ G++INY+GASG+ Sbjct: 311 AFLLALAIEQNGSAEREGLSQALRSVSSAPGEVILPGEWEKAVELIAAGEEINYEGASGS 370 Query: 409 VDIDANGDVIGV 420 + D NGDV GV Sbjct: 371 HEFDENGDVPGV 382 Lambda K H 0.312 0.130 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 375 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 441 Length of database: 401 Length adjustment: 32 Effective length of query: 409 Effective length of database: 369 Effective search space: 150921 Effective search space used: 150921 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory