Align 2-methylcitrate synthase (EC 2.3.3.5) (characterized)
to candidate WP_086510765.1 BZY95_RS15300 citrate (Si)-synthase
Query= reanno::pseudo6_N2E2:Pf6N2E2_6062 (375 letters) >NCBI__GCF_002151265.1:WP_086510765.1 Length = 427 Score = 197 bits (501), Expect = 4e-55 Identities = 127/391 (32%), Positives = 205/391 (52%), Gaps = 27/391 (6%) Query: 2 AEAKVLSGAGLRGQVAGQTALSTVGQSGAGLTYRGYDVRDLAADAQFEEVAYLLLYGELP 61 AE G + Q+A++ + + L +RGY + LA ++ F EV Y LL+GELP Sbjct: 38 AEGLFTYDPGFMATSSCQSAITYIDGAKGVLLHRGYPIDQLAKESNFVEVCYALLFGELP 97 Query: 62 TQAQLDAYTGKLRQLRDLPQALKEVLERIPADAHPMDVMRTGCSFLGNL----EPEQDFS 117 T Q + ++R + + + DAHPM ++ C +G L D + Sbjct: 98 TDEQYADFESRVRNHTMVHDQINNFFKGFRRDAHPMSIL---CGVVGGLAAFYHDHLDIT 154 Query: 118 QQHDK---TDRLLAAFPAIMCYWYRFSHQGQRIECVTDEVSIGGHFLHLLHGK-----KP 169 + D+ RL+A P I Y+++ GQ +++S +FL+++ K Sbjct: 155 VEEDRIISAIRLIAKMPTIAAMSYKYN-VGQPFNYPRNDLSYAENFLYMMFSNPCEEYKV 213 Query: 170 SELHVKVMNVSLILYAEHEFNASTFTARVCASTLSDLFSCITAAIGSLRGPLHGGANEAA 229 + ++ K M+ +L+A+HE NAST T R+ ST ++ F+CI+A I +L GP HGGANEA Sbjct: 214 NPVYAKAMDRIFMLHADHEQNASTSTVRLAGSTGANPFACISAGIAALWGPAHGGANEAV 273 Query: 230 MEMIERF-SSPQEAIEGTLGMLARKD---KIMGFGHAIYKDNDPRNEVIKGWSKKLADEV 285 ++M++ +E I+ + KD K+MGFGH +Y++ DPR +V+K ++ E+ Sbjct: 274 LKMLDEIGDDSEENIQRFIDKAKDKDDPFKLMGFGHRVYRNFDPRAKVMKETCDEVLAEL 333 Query: 286 G-DTVLFPVSEAIDKTMWE-----QKKLFPNADFYHASAYHFMGIPTKLFTPIFVCSRLT 339 G D +++ +++ E ++KL+PN DFY MGIPT +FT IF SR Sbjct: 334 GIDDPQLKIAKRLEQIALEDEYFVERKLYPNVDFYSGIILKAMGIPTNMFTVIFAVSRTI 393 Query: 340 GWAAHVFEQRANN-RIIRPSAEYTGVEQRKF 369 GW +H E +N+ +I RP YTG QR + Sbjct: 394 GWISHWHEMLSNDYKIGRPRQLYTGHPQRDY 424 Lambda K H 0.321 0.135 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 393 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 427 Length adjustment: 31 Effective length of query: 344 Effective length of database: 396 Effective search space: 136224 Effective search space used: 136224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory