Align Glyoxylate reductase; EC 1.1.1.26 (uncharacterized)
to candidate WP_086508280.1 BZY95_RS01720 3-phosphoglycerate dehydrogenase
Query= curated2:Q9YAW4 (335 letters) >NCBI__GCF_002151265.1:WP_086508280.1 Length = 315 Score = 166 bits (420), Expect = 7e-46 Identities = 111/302 (36%), Positives = 161/302 (53%), Gaps = 21/302 (6%) Query: 24 YDVEVWDKYQPPPYETLLSKAREADALYTLLTDR--IDCDLLSQAPRLRIVAQMAVGFDN 81 YD V D+ + L+ + R+ADAL L+ +R I LL++ P L+ ++Q G + Sbjct: 30 YDDTVTDE------DALVERFRDADAL-VLIRERTPITESLLARLPNLKAISQTGGGAAH 82 Query: 82 IDVECATRLGIYVTNTPGVLTEATAEFTWALILAAARRVVEADHFVRWGEWWRLRTGWHP 141 +D+ R G+ V G A AE TW L+LAA R + E ++ G W R Sbjct: 83 VDMAACKRHGVTVMAGTGS-PYAAAELTWGLVLAAMRHIPEEFENLKAGRWQRT------ 135 Query: 142 MMMLGVELRGKTLGILGMGRIGSRVAEIGKAFGMRIIYHSRSRKREIEKELGAEYRSLE- 200 LG L+G+TLGI G G+IG +A G+AF M ++ R R E G E + + Sbjct: 136 ---LGTGLKGRTLGIFGYGKIGKLIARYGQAFEMNVLVWGREGTRTRAAEAGLEVAASQA 192 Query: 201 DLLRESDILSIHLPLTDETRHLIGESELKLMKKTAILVNTGRGAIVDTGALVKALREGWI 260 +L SD+LS+HL L +TR ++ +L MK TA+LVNT R ++ GAL ALREG Sbjct: 193 ELFERSDVLSLHLRLNADTRGIVSAEDLARMKPTALLVNTSRAPLIAPGALETALREGRP 252 Query: 261 AAAALDVFEEEPLNPNHPLTAFKNVVLAPHAASATRETRLRMAMMAAENLVAFAQGKVPP 320 AA+DVF+EEP+ +HPL A N + PH +++ A +NL+AF G+ Sbjct: 253 GRAAVDVFDEEPVT-SHPLLALPNFLATPHLGYVEKDSYELYFGDAFDNLLAFDAGRPVK 311 Query: 321 NL 322 NL Sbjct: 312 NL 313 Lambda K H 0.322 0.136 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 241 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 315 Length adjustment: 28 Effective length of query: 307 Effective length of database: 287 Effective search space: 88109 Effective search space used: 88109 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory