Align Glyoxylate reductase; EC 1.1.1.26 (characterized)
to candidate WP_086511882.1 BZY95_RS21230 hydroxyacid dehydrogenase
Query= SwissProt::Q9C4M5 (331 letters) >NCBI__GCF_002151265.1:WP_086511882.1 Length = 331 Score = 198 bits (503), Expect = 2e-55 Identities = 118/329 (35%), Positives = 175/329 (53%), Gaps = 17/329 (5%) Query: 1 MKPKVFITRQIPENGIKMIEKFYEIELWKDPKAPPRGVLLEKVREVDALVTLVTDKVDKE 60 M K+ IT + E+ + E+++ D + P + + + A++ +TD+VD E Sbjct: 1 MTDKILITHPVHEDVYHRLAAVAEVDMNPDLEPWPYAEVCRRAADATAIMGFMTDRVDTE 60 Query: 61 LLENAPKLKIIAQYAVGYDNIDIEEATKRGIYVTNTPGVLTDATADLAFALLLAVARRIV 120 LL NAP+LKIIA GYDN D E + G++++ P +LT TA+LA AL L +AR + Sbjct: 61 LLTNAPRLKIIACALKGYDNYDAEACAQAGVWLSIVPDLLTAPTAELAVALALGLARHVR 120 Query: 121 EADAFVRSGEWKKSEVGWHPLMFLGYGLKGKTLGIVGFGRIGQALAKRAKGFGMKIIYYS 180 DAFVR G ++ GW P F GYGL T+ ++G GR+G AL +R +GFG I Sbjct: 121 AGDAFVRQGNYR----GWRP-HFYGYGLHNSTVAVLGLGRLGSALVERLQGFGCARILGV 175 Query: 181 RTRKPEAEEEIGAEYVDFETLLKESDFISLHVPLTKETYHMIGEKELKLMKPNAILINTS 240 T G + L ++DF+ +PL++ET+H++ L+ KP +LIN Sbjct: 176 DTHASLP----GVVNCSLQDALAQADFVFSLLPLSEETWHLLDAAHLRACKPGQLLINVG 231 Query: 241 RGAVVDTNALIKALKEGWIAGAGLDVFEEEPY-YNEELFKL-------KNVVLAPHIGSA 292 RG+VVD A+ L EG + G DVF E + Y E L K+ +N + PH+GSA Sbjct: 232 RGSVVDELAVADVLAEGRLGGYAADVFSCEDWAYLERLRKIPDALLLAENTLFTPHLGSA 291 Query: 293 THEAREGMAELVAKNLIAFAKGEIPPNLV 321 H AR + A N++A G P + V Sbjct: 292 VHSARRAIEHRAADNILAVLAGRAPEDAV 320 Lambda K H 0.317 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 258 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 331 Length adjustment: 28 Effective length of query: 303 Effective length of database: 303 Effective search space: 91809 Effective search space used: 91809 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory