Align Xylonolactonase (EC 3.1.1.68) (characterized)
to candidate WP_086511018.1 BZY95_RS16655 SMP-30/gluconolactonase/LRE family protein
Query= reanno::Korea:Ga0059261_1893 (295 letters) >NCBI__GCF_002151265.1:WP_086511018.1 Length = 295 Score = 166 bits (420), Expect = 6e-46 Identities = 106/290 (36%), Positives = 142/290 (48%), Gaps = 10/290 (3%) Query: 2 GVVLTAPEPVWALGAPLLEGPVWVQRDAALWFVDIKSHRIHRFDPASGERRSWDAPAQVG 61 G++ A E +LG E PVW L++ DI + ++ + P G + Sbjct: 4 GMIEVAVELDMSLG----ESPVWSVARQTLFWADINNGHVYAWRPQQGGAPLRSELGEKV 59 Query: 62 FCLPAANGKFVAGLQTGLAIFDPADRSFTPLTDPE--PALPGNRLNDGTVDPAGRLWFGT 119 C+ VA +G+ +PE A GNR NDG D AGRLW GT Sbjct: 60 GCVALDEAGLVAATASGILRLPENGEPERLADNPEWKKAGQGNRFNDGRCDAAGRLWVGT 119 Query: 120 MDDGESEATGRIYRLGGDGRCVAETAAVSISNGPAVSPDGRTLYHVDTLGG-VIHSAAIG 178 +D E+ + +Y L G + ISNG A SPD R LYH D+L ++ Sbjct: 120 IDADEASPSAALYCLD-KGELSRRVTGLGISNGLAFSPDRRWLYHTDSLSRRILRYPFDV 178 Query: 179 DDGILGDSRVFATIPNS--EGFPDGPAVDAEGCVWIGLYNGAAVRRYSPAGELLDVVAFP 236 D G LG+ + + G PDG AVD+EGC W LY+G + R+SP GEL+ P Sbjct: 179 DSGTLGEGEAWVDLERLGLPGVPDGAAVDSEGCYWSALYDGGRIVRFSPEGELVAEHEVP 238 Query: 237 VGAITKVAFGGPDLRTVYATTASKHLDADGRAEEPHAGDLFAFRVSVPGM 286 T VAFGG DLRT+Y TTA++HLDA+G+A P AG L R V G+ Sbjct: 239 CPHPTMVAFGGADLRTLYITTATQHLDAEGKARWPQAGSLLQMRTGVTGL 288 Lambda K H 0.319 0.139 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 362 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 295 Length adjustment: 26 Effective length of query: 269 Effective length of database: 269 Effective search space: 72361 Effective search space used: 72361 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory