Align arogenate dehydratase (EC 4.2.1.91) (characterized)
to candidate BPHYT_RS19370 BPHYT_RS19370 arogenate dehydratase
Query= BRENDA::Q01269 (268 letters) >FitnessBrowser__BFirm:BPHYT_RS19370 Length = 265 Score = 257 bits (657), Expect = 2e-73 Identities = 124/241 (51%), Positives = 169/241 (70%), Gaps = 2/241 (0%) Query: 20 SASLQAQESRLDRILESGVLRVATTGDYKPFSYRTEEGGYAGFDVDMAQRLAESLGAKLV 79 +++ A SRLD IL G LR TTGDYKP+S+ +G + G D+DM + LA+SLG K Sbjct: 26 TSATTATPSRLDEILARGTLRACTTGDYKPYSFYKADGQFEGIDIDMTESLAKSLGVKTE 85 Query: 80 VVPTSWPNLMRDFADDRFDIAMSGISINLERQRQAYFSIPYLRDGKTPITLCSEEARFQT 139 + TSW NLM DF + D+ + G+S LERQ++A+F+ Y+ DGKTPI C + ++QT Sbjct: 86 YIKTSWSNLMNDFVA-KCDVGVGGVSPTLERQKRAFFTQAYMVDGKTPIVRCDDVNKYQT 144 Query: 140 LEQIDQPGVTAIVNPGGTNEKFARANLKKARILVHPDNVTIFQQIVDGKADLMMTDAIEA 199 + QIDQP IVNPGGTNE+FA+ A + V+PDNVTIF+QI+ GKAD+M+TDA E Sbjct: 145 VAQIDQPATRVIVNPGGTNERFAKQYFPHANLTVYPDNVTIFKQILAGKADVMVTDASET 204 Query: 200 RLQSRLHPELCAVHPQQPFDFAEKAYLLPR-DEAFKRYVDQWLHIAEQSGLLRQRMEHWL 258 LQ +L+P LC+VHP +PF + EKA+LLPR D AF++YVDQWLH+A +G + + WL Sbjct: 205 LLQQKLNPGLCSVHPDKPFQYGEKAWLLPRGDVAFQQYVDQWLHLARATGEYQAISDKWL 264 Query: 259 E 259 + Sbjct: 265 K 265 Lambda K H 0.322 0.135 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 219 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 268 Length of database: 265 Length adjustment: 25 Effective length of query: 243 Effective length of database: 240 Effective search space: 58320 Effective search space used: 58320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory