GapMind for Amino acid biosynthesis

 

Alignments for a candidate for leuD in Paraburkholderia bryophila 376MFSha3.1

Align 3-isopropylmalate dehydratase small subunit; EC 4.2.1.33; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase (uncharacterized)
to candidate H281DRAFT_02981 H281DRAFT_02981 aconitase /2-methylcitrate dehydratase (trans-methylaconitate-forming)

Query= curated2:Q8ZW36
         (161 letters)



>FitnessBrowser__Burk376:H281DRAFT_02981
          Length = 865

 Score = 46.2 bits (108), Expect = 1e-09
 Identities = 24/64 (37%), Positives = 40/64 (62%), Gaps = 1/64 (1%)

Query: 45  FPKKAKGAVLVAGRAFGMGSSREQAALALKGAGVLAVVAESFARIFFRNAINVG-LPVLQ 103
           + ++ +  +++AG  +G GSSR+ AA  ++ AG  A+VAE F RI   N + +G LP+  
Sbjct: 727 YMERKQPLIVIAGADYGQGSSRDWAAKGVRLAGAEAIVAEGFERIHRTNLVGMGVLPLEF 786

Query: 104 APGI 107
            PG+
Sbjct: 787 KPGV 790


Lambda     K      H
   0.319    0.141    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 304
Number of extensions: 17
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 161
Length of database: 865
Length adjustment: 29
Effective length of query: 132
Effective length of database: 836
Effective search space:   110352
Effective search space used:   110352
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)

This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory