Align homoisocitrate dehydrogenase (EC 1.1.1.87) (characterized)
to candidate H281DRAFT_06345 H281DRAFT_06345 tartrate dehydrogenase/decarboxylase / D-malate dehydrogenase
Query= BRENDA::Q5SIJ1 (334 letters) >FitnessBrowser__Burk376:H281DRAFT_06345 Length = 360 Score = 220 bits (560), Expect = 5e-62 Identities = 143/356 (40%), Positives = 199/356 (55%), Gaps = 28/356 (7%) Query: 3 YRICLIEGDGIGHEVIPAARRVLEAT----GLPLEFVEAE-AGWETFERRGTSVPEETVE 57 YRI +I GDGIG EV+P A RVL+ G+ LE+ E A + + + G +P++ Sbjct: 5 YRIAVIPGDGIGVEVMPEALRVLDTVKARFGIELEYQHIEWASCDYYAKHGQMMPDDWKA 64 Query: 58 KILSCHATLFGAATSPTRKVP---GFFGAIRYLRRRLDLYANVRPAK-----SRPVPGSR 109 ++ S A LFGA P VP +G++ RR D Y N+RPA+ P+ G + Sbjct: 65 QLQSADAILFGAVGWPDT-VPDHISLWGSLLKFRREFDQYINLRPARLFAGVPSPLAGRK 123 Query: 110 PG-VDLVIVRENTEGLY-----VEQERRYLDVAIADAVISKKASERIGRAALRIAEGRPR 163 G +D IVRENTEG Y V E + + ++V ++ SER+ + A +A+ R R Sbjct: 124 AGDIDFWIVRENTEGEYSSVGGVMFEGTEREFVLQESVFTRHGSERVLKFAFDLAQRRER 183 Query: 164 KTLHIAHKANVLPLTQGLFLDTVKEVAKDFPLVNVQDIIVDNCAMQLVMRPERFDVIVTT 223 K + +A K+N + ++ + +A +P V +D +LV+ P+RFDV+V T Sbjct: 184 KKITVATKSNGIAISMPWWDKCAAGIAAQYPDVTWDKQHIDILCARLVLNPDRFDVVVAT 243 Query: 224 NLLGDILSDLAAGLVGGLGLAPSGNIGDT---TAVFEPVHGSAPDIAGKGIANPTAAILS 280 NL GDILSDL G +GLAPSGN+ ++FEPVHGSAPDIAGK IANP A I S Sbjct: 244 NLFGDILSDLGPACTGTIGLAPSGNLNPDRKFPSLFEPVHGSAPDIAGKNIANPIAMIWS 303 Query: 281 AAMMLDYLG-----EKEAAKRVEKAVDLVLERGPRTPDLGGDATTEAFTEAVVEAL 331 AAMMLD+LG E+EA + A++ L GP T DLGG A T +A+ L Sbjct: 304 AAMMLDFLGNHEGKEREAHDAILAAIEATLIEGPHTGDLGGKANTTEVGQAIAAKL 359 Lambda K H 0.319 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 325 Number of extensions: 19 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 360 Length adjustment: 29 Effective length of query: 305 Effective length of database: 331 Effective search space: 100955 Effective search space used: 100955 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory