Align phosphoribosylanthranilate isomerase (EC 5.3.1.24) (characterized)
to candidate H281DRAFT_05658 H281DRAFT_05658 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
Query= BRENDA::P16250 (240 letters) >FitnessBrowser__Burk376:H281DRAFT_05658 Length = 250 Score = 143 bits (361), Expect = 3e-39 Identities = 87/229 (37%), Positives = 127/229 (55%), Gaps = 9/229 (3%) Query: 6 LLPAVDVRDGQAVRLVHGESGTETSYGS-PLEAALAWQRSGAEWLHLVDLDAAF-GTGDN 63 L+PA+D++DGQ VRL G+ T + P A W GA LHLVDL+ AF G N Sbjct: 3 LIPAIDLKDGQCVRLKQGDMDQATIFSEEPAAMARHWVERGARRLHLVDLNGAFAGKPRN 62 Query: 64 ----RALIAEVAQAMDIKVELSGGIRDDDTLAAALATGCTRVNLGTAALETPEWVAKVIA 119 RA+I EV +I V+L GGIRD +T+ L G V +GTAA++ P ++ Sbjct: 63 EEAIRAIIEEVGG--EIPVQLGGGIRDLNTIERYLDDGLEYVIIGTAAVKNPGFLQDACT 120 Query: 120 EHGDKIAVGLDVRGTTLRGRGWTR-DGGDLYETLDRLNKEGCARYVVTDIAKDGTLQGPN 178 G I VGLD + + GW++ G ++ + + GC + TDI +DG LQG N Sbjct: 121 AFGGHIIVGLDAKDGKVATDGWSKLTGHEVADLARKFEDYGCESIIYTDIGRDGMLQGIN 180 Query: 179 LELLKNVCAATDRPVVASGGVSSLDDLRAIAGLVPAGVEGAIVGKALYA 227 +E + A PV+ASGG+S+L D+ ++ + G+EG I G+A+Y+ Sbjct: 181 IEATVRLARAVKIPVIASGGLSNLTDIESLCEVEDEGIEGVICGRAIYS 229 Lambda K H 0.315 0.133 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 250 Length adjustment: 24 Effective length of query: 216 Effective length of database: 226 Effective search space: 48816 Effective search space used: 48816 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory