Align L-serine ammonia-lyase (EC 4.3.1.17) (characterized)
to candidate CCNA_03740 CCNA_03740 cysteine synthase
Query= BRENDA::Q96GA7 (329 letters) >FitnessBrowser__Caulo:CCNA_03740 Length = 328 Score = 46.2 bits (108), Expect = 1e-09 Identities = 52/160 (32%), Positives = 75/160 (46%), Gaps = 14/160 (8%) Query: 34 VFLKCENVQPSGSFKIR-GIGHF----CQEMAKKGCRHLVCSSGGNAGIAAAYAARKLGI 88 V K E P S K R G+ Q + K G ++ + GN GIA A+ A G Sbjct: 50 VLAKLEFFNPIASVKDRIGVSMIESLEAQGVLKPGAT-IIEPTSGNTGIALAFVAAAKGY 108 Query: 89 PATIVLPESTSLQVVQRLQGEGAEVQLT--GKVWDEANLRAQELAKRDGWENVP-PFD-- 143 T+V+PES S++ + L GA+++LT K A RAQEL + +P F+ Sbjct: 109 KLTLVMPESMSIERRKMLLLLGAKLELTPAEKGMRGAVTRAQELIEATPGAVMPQQFENS 168 Query: 144 -HPLIWKGHASLVQELKAVLRTPPGALVLAVGGGGLLAGV 182 +PLI + S +E+ A+V VG GG + GV Sbjct: 169 ANPLIHR--VSTAEEIWNDTAGAVDAVVSGVGTGGTITGV 206 Lambda K H 0.319 0.134 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 328 Length adjustment: 28 Effective length of query: 301 Effective length of database: 300 Effective search space: 90300 Effective search space used: 90300 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory