Align Dihydroxy-acid dehydratase; DAD; EC 4.2.1.9 (uncharacterized)
to candidate CCNA_02134 CCNA_02134 phosphogluconate dehydratase
Query= curated2:A8AB39 (552 letters) >FitnessBrowser__Caulo:CCNA_02134 Length = 602 Score = 282 bits (721), Expect = 3e-80 Identities = 182/520 (35%), Positives = 274/520 (52%), Gaps = 33/520 (6%) Query: 32 PLIGVANSWNEIVPGHVHLDKVAEAVKAGIRMAGGTPLEFGTI-AVCDGIAMGHEGMRYS 90 P IG+ +++N+++ H L+ +K R G T G + A+CDG+ G GM S Sbjct: 68 PNIGIVSAYNDMLSAHQPLEAYPALIKDAARDVGATAQFAGGVPAMCDGVTQGRPGMELS 127 Query: 91 LPSREVIADTVEIMVEAHRLDAVVMVTNCDKITPGFLLAAARLE-VPVILINGGPMMPGV 149 L SR+VIA + + D+ + + CDKI PG ++ A +P + + GPM G+ Sbjct: 128 LFSRDVIAMATAVALTHDAFDSALYLGVCDKIVPGLVIGALTFSHLPALFVPAGPMTSGL 187 Query: 150 YGKERIDFKDLMERMNVLIKEGRT--EELRKLEESALPGPGSCAGLFTANTMNMLSEAMG 207 E+ R+ L EG+ EEL E ++ GPG+C TANT ML E MG Sbjct: 188 PNSEKA-------RIRALYAEGKVGREELLAAESASYHGPGTCTFYGTANTNQMLMELMG 240 Query: 208 LMLPGASTVPAVEARRLWYAKLTGMRIVKMVEEG---LTPDKILTRKALENAIAVDMALG 264 LPG++ V R K + R+ + +G + +++ K+ N + MA G Sbjct: 241 FHLPGSAFVHPNTPLREALVKESARRVAAVTNKGNEFIPVGRMIDEKSFVNGVVGLMATG 300 Query: 265 GSTNSVLHLEALAYELGIDLPLEVFDEISRKVPHIASISPSGRHFVVDLDRAGGIPAVLK 324 GSTN LH+ A+A G+ L LE D+IS+ P +A + P+G V AGG+ V++ Sbjct: 301 GSTNLALHIIAMAAAAGVQLTLEDLDDISKATPLLARVYPNGSADVNHFQAAGGMAFVIR 360 Query: 325 ELGEAGLIHKDALTVTGKTVWENVKDAAV--------------LDREVIRPLDNPYSPFG 370 EL +AGL+H+D T+ G + K+ + LD ++RP+ +P+S G Sbjct: 361 ELLKAGLVHEDVQTIAGAGLSLYAKEPVLEDGMLTWRDGAHESLDPAIVRPVSDPFSKEG 420 Query: 371 GLAILKGSLAPNGAVVKASAVKRELWKFKGVARVFDREEDAVKAIRGGEIEPGTVIVIRY 430 GL ++ G+L V+K SAVK E + VF +ED + A + GE++ V+V+R+ Sbjct: 421 GLRLMAGNL--GRGVMKISAVKPEHHVIEAPCAVFQEQEDFIAAFKRGELDRDVVVVVRF 478 Query: 431 EGPRGGPGMREMLTATAAV-MALGLGDKVALVTDGRFSGAT-RGPAIGHVSPEAAAGGPI 488 +GP GM E+ + ++ + L G KVALVTDGR SGA+ + PA HV+PEAA GGP+ Sbjct: 479 QGPSAN-GMPELHNLSPSISVLLDRGHKVALVTDGRMSGASGKTPAAIHVTPEAAKGGPL 537 Query: 489 ALVQDGDEIVIDIEKRRLDLLVDEKELEERRARWKPKVKP 528 A VQDGD I ++ E L ++VDE L R P KP Sbjct: 538 AYVQDGDVIRVNAETGELKIMVDEATLLARTPANVPASKP 577 Lambda K H 0.319 0.138 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 892 Number of extensions: 61 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 552 Length of database: 602 Length adjustment: 36 Effective length of query: 516 Effective length of database: 566 Effective search space: 292056 Effective search space used: 292056 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory