Align 3-isopropylmalate dehydratase small subunit; EC 4.2.1.33 (characterized, see rationale)
to candidate Echvi_2060 Echvi_2060 3-isopropylmalate dehydratase, small subunit
Query= uniprot:A0A1X9Z766 (195 letters) >FitnessBrowser__Cola:Echvi_2060 Length = 197 Score = 265 bits (676), Expect = 5e-76 Identities = 126/193 (65%), Positives = 155/193 (80%) Query: 3 KFTKLTSAVVPLNIENIDTDQIIPARFLKATTREGFGENLFRDWRYENDNQPKADFVMNN 62 KF L S VVPL EN+DTDQIIPARFLKAT R+GFG+NLFRDWRY+++ PKADFV+N+ Sbjct: 5 KFNILKSTVVPLPTENVDTDQIIPARFLKATERKGFGDNLFRDWRYDSEGNPKADFVLND 64 Query: 63 PTYSGQVLVAGKNFGCGSSREHAAWAIQDAGFDAVISSFFADIFKGNALNNGLLPIQVSD 122 TYSG+VLVAGKNFG GSSREHAAWAI D GF V+SSFFADIFK NALN G+LP+ V+ Sbjct: 65 ATYSGKVLVAGKNFGSGSSREHAAWAIYDYGFRCVVSSFFADIFKNNALNIGILPVTVTP 124 Query: 123 EFLAQIFKAVDNNPKSALEVDLENQTVTIVETGAQESFEINPYKKSCLINGYDDIDFILN 182 EFL +IF V+ +P + +EVD+E QT+T++ TG ESF+IN YKK + NG+DDID++LN Sbjct: 125 EFLEEIFAEVEKDPATEVEVDIEKQTITLLSTGNSESFDINSYKKQNMQNGFDDIDYLLN 184 Query: 183 QKQLIEEFEEGRR 195 K I EFE+ R+ Sbjct: 185 MKDQIVEFEKTRK 197 Lambda K H 0.318 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 202 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 195 Length of database: 197 Length adjustment: 20 Effective length of query: 175 Effective length of database: 177 Effective search space: 30975 Effective search space used: 30975 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
Align candidate Echvi_2060 Echvi_2060 (3-isopropylmalate dehydratase, small subunit)
to HMM TIGR00171 (leuD: 3-isopropylmalate dehydratase, small subunit (EC 4.2.1.33))
../bin/blast/fastacmd -i /tmp/list.10402.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.10402.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.