Align Alanine--glyoxylate aminotransferase; EC 2.6.1.44 (characterized)
to candidate 208639 DVU3121 aminotransferase, class V (TIGR)
Query= SwissProt::Q3LSM4 (393 letters) >FitnessBrowser__DvH:208639 Length = 376 Score = 213 bits (542), Expect = 7e-60 Identities = 130/354 (36%), Positives = 182/354 (51%), Gaps = 2/354 (0%) Query: 21 LLMGPGPSNAPQRVLDAMSRPILGHLHPETLKIMDDIKEGVRYLFQTNNIATFCLSASGH 80 LLMG GPS P V A++ P +G L P +I+D ++ +R +F ++ L Sbjct: 19 LLMGDGPSGVPDSVYSALALPTVGPLDPGFDEILDRLQGQLRNIFNVSDGVCAVLDGPAA 78 Query: 81 GGMEATLCNLLEDGDVILIGHTGHWGDRSADMATRYGADVRVVKSKVGQSLSLDEIRDAL 140 GME L NLLE G+ +L+ G G+R + A R G V V+ G + +++ L Sbjct: 79 VGMETCLVNLLEPGERLLVLDNGMGGERLRETAQRLGLAVDVLTVPWGDPVLSEQVAQRL 138 Query: 141 LIHKPSVLFLTQGDSSTGVLQGLEGVGALCHQHNCLLIVDTVASLGGAPMFMDRWEIDAM 200 + + +SSTGV + VG L H L IVD SLGG + M RW DA+ Sbjct: 139 ARSDYHAVVMVHAESSTGVRSPVGAVGDLVSMHGALFIVDCETSLGGMDVDMARWRADAL 198 Query: 201 YTGSQKVLGAPPGITPVSFSHRAVERYKRRNTKVKVYYWDMSLVGDYWGCFGRPRIYHHT 260 + S K L PPG+ PV+FS RA++R RR T + Y+D++L DYW G PR+ H Sbjct: 199 FASSHKCLSCPPGLAPVAFSMRALDRVGRRRTPIPGRYFDIALHLDYWQ--GAPRVCHLM 256 Query: 261 ISSTLLYGLREAIAMACEEGLPALIARHEDCAKRLYRGLQDAGFELYADPKDRLSTVTTI 320 S LLY L A+ EGLP + ARH ++L GL G AD RL + + Sbjct: 257 PSVNLLYALHMALEGVLNEGLPNVFARHRAAHEQLVTGLAALGLRPLADVPWRLPMLHVV 316 Query: 321 KVPQGVDWLKAAQYAMKTYLVEISGGLGPTAGQVFRIGLMGQNATTERVDRVLQ 374 P+GVD + +EI GG+G AG+V+RIGLMG +A T V +L+ Sbjct: 317 PAPEGVDAEDVRGRLRAEHGIEIGGGVGRLAGRVWRIGLMGHSARTTNVVALLE 370 Lambda K H 0.321 0.137 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 406 Number of extensions: 26 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 376 Length adjustment: 30 Effective length of query: 363 Effective length of database: 346 Effective search space: 125598 Effective search space used: 125598 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory