GapMind for Amino acid biosynthesis

 

Alignments for a candidate for dapH in Desulfovibrio vulgaris Hildenborough JW710

Align 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase; EC 2.3.1.89; Tetrahydrodipicolinate N-acetyltransferase; THP acetyltransferase; Tetrahydropicolinate acetylase (uncharacterized)
to candidate 209281 DVU0347 transferase, hexapeptide repeat family (TIGR)

Query= curated2:Q9K9H8
         (240 letters)



>FitnessBrowser__DvH:209281
          Length = 223

 Score = 72.4 bits (176), Expect = 7e-18
 Identities = 45/131 (34%), Positives = 67/131 (51%), Gaps = 28/131 (21%)

Query: 99  IIRDQVEIGDNAVIMMGASINIGSVIGEGTMIDMNVVLGGRATVGKNCHIGAGSVLAGVI 158
           I+ D V +   A+     +I IG    +GTM+  N V+        + H          +
Sbjct: 110 ILEDGVSLNGTAITARSRTIRIG----KGTMVAPNCVI-----TDSDFH---------AM 151

Query: 159 EPPSAK----------PVVVEDDVVIGANCVILEGVTVGKGAVVAAGAVVTEDVPPNTVV 208
            PP  +           V +   V +G  C++L+GVT+G GA+VAAG+VVT DVPP T+V
Sbjct: 152 WPPETRLDTPAFERDADVTIGQHVWLGMRCIVLKGVTIGDGAIVAAGSVVTRDVPPATLV 211

Query: 209 AGTPARVIKEI 219
           AG PARV++ +
Sbjct: 212 AGVPARVVRHL 222


Lambda     K      H
   0.314    0.135    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 124
Number of extensions: 10
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 240
Length of database: 223
Length adjustment: 23
Effective length of query: 217
Effective length of database: 200
Effective search space:    43400
Effective search space used:    43400
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 46 (22.3 bits)

This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory