Align Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; Transaminase A; EC 2.6.1.1; EC 2.6.1.39 (characterized)
to candidate 209328 DVU0392 aromatic aminotransferase (TIGR)
Query= SwissProt::P58350 (410 letters) >FitnessBrowser__DvH:209328 Length = 399 Score = 204 bits (518), Expect = 5e-57 Identities = 132/373 (35%), Positives = 200/373 (53%), Gaps = 21/373 (5%) Query: 44 IILGAGEPDFDTPEHVKQAASDAIH--RGETKYTALDGTPELKKAIREKFQRENGLAYEL 101 + LG G P F TPEH+ +A A+ +YT G P L++AI G Sbjct: 33 VSLGQGVPSFRTPEHIVEAVCRALRDKADAGRYTLQPGMPALREAIAADLAARKGYMVNP 92 Query: 102 D-EITVATGAKQILFNAMMASLDPGDEVIIPTPYWTSYSDIVHICEGKPVLIACDASSGF 160 D E+ V GA + L A++ +D GDEVIIP+P + S+++ V + EG PV + A + Sbjct: 93 DSEVGVTVGAMEALLMALLTVVDRGDEVIIPSPGYASHAEQVLMAEGVPVHVPLRADD-W 151 Query: 161 RLTAEKLEAAITPRTRWVLLNSPSNPSGAAYSAADYRPLLEVLLRHPHVWLLVDDMYEHI 220 L + + AA+TPRTR V++ +P NP+G Y AD R L E+ L ++ L+ D+ Y+++ Sbjct: 152 GLDVDAIRAAVTPRTRAVIVCNPGNPTGTVYDDADVRALCELALER-NIMLISDETYDYM 210 Query: 221 VYDGFRFVTPAQLEPGLKNRTLTVNGVSKAYAMTGWRIGYAGGPRELIKAMAVVQSQATS 280 VY G ++PA L P ++ + VN SK YA+TGWR+GY + + V A Sbjct: 211 VYGGGEPLSPASL-PEMRRHVIVVNSFSKKYALTGWRVGYCAADAAWMGELLKVHDAAAI 269 Query: 281 CPSSISQAASVAALNGPQDFLKERTESFQRRRDLVVNGLNAI-DGLDCRVPEGAFYTFSG 339 C ++SQ A++AAL GPQD + + + RR+L L+A+ D P GAFY Sbjct: 270 CAPAVSQYAALAALTGPQDCVDDMRAALSARRNLACARLDAMAPHFDYVQPRGAFY---- 325 Query: 340 CAGVLGKVTPSGKRIKTDTDFCA-YLLEDAHVAVVPGSAFGLS--PFFRISYATSEAELK 396 ++ + T + +D A LLE+ V VPG++FG + R+S+ EAEL Sbjct: 326 ---IMARYTFT----DAPSDMVARRLLEEGRVITVPGASFGPTGERHLRLSFGMEEAELD 378 Query: 397 EALERIAAACDRL 409 EA +R+AA R+ Sbjct: 379 EAFDRMAAWTQRV 391 Lambda K H 0.318 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 431 Number of extensions: 32 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 410 Length of database: 399 Length adjustment: 31 Effective length of query: 379 Effective length of database: 368 Effective search space: 139472 Effective search space used: 139472 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory