Align IGP synthase glutamine amidotransferase subunit; EC 2.4.2.- (characterized)
to candidate N515DRAFT_2934 N515DRAFT_2934 glutamine amidotransferase
Query= CharProtDB::CH_024511 (196 letters) >FitnessBrowser__Dyella79:N515DRAFT_2934 Length = 196 Score = 177 bits (450), Expect = 8e-50 Identities = 91/197 (46%), Positives = 129/197 (65%), Gaps = 2/197 (1%) Query: 1 MNVVILDTGCANLNSVKSAIARHGYEPKVSRDPDVVLLADKLFLPGVGTAQAAMDQVRER 60 M VV++D G N+ SV+ A+ R G + ++ D + + AD++ LPGVG A M ++RE Sbjct: 1 MAVVLVDAGGTNIGSVRYALQRLGVDAALTSDANAIRQADRVILPGVGAAGPGMARLREL 60 Query: 61 ELFDLIKACTQPVLGICLGMQLLGRRSEESNGVDLLGIIDEDVPKMTDF-GLPLPHMGWN 119 L +LI++ TQPVLG+CLGMQLL RSEE + L +I + + GL +PHMGWN Sbjct: 61 GLVELIRSLTQPVLGVCLGMQLLFERSEEG-ATECLAVIPGAASRFAEAPGLRVPHMGWN 119 Query: 120 RVYPQAGNRLFQGIEDGAYFYFVHSYAMPVNPWTIAQCNYGEPFTAAVQKDNFYGVQFHP 179 R+ + + L G+ A+ YFVHSYA+P N T+A ++G F+A V + NF+G+QFHP Sbjct: 120 RLRVERAHPLVAGLGTDAWAYFVHSYAVPANDSTLATADFGGAFSAVVARGNFHGMQFHP 179 Query: 180 ERSGAAGAKLLKNFLEM 196 ERS GA+LLKNFLE+ Sbjct: 180 ERSAGVGARLLKNFLEL 196 Lambda K H 0.322 0.140 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 129 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 196 Length of database: 196 Length adjustment: 20 Effective length of query: 176 Effective length of database: 176 Effective search space: 30976 Effective search space used: 30976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
Align candidate N515DRAFT_2934 N515DRAFT_2934 (glutamine amidotransferase)
to HMM TIGR01855 (hisH: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit (EC 2.4.2.-))
../bin/blast/fastacmd -i /tmp/list.4603.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.4603.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.