Align Acetolactate synthase small subunit; Short=AHAS; Short=ALS; EC 2.2.1.6 (characterized, see rationale)
to candidate N515DRAFT_0566 N515DRAFT_0566 acetolactate synthase, small subunit
Query= uniprot:A0A154R0Y7 (82 letters) >FitnessBrowser__Dyella79:N515DRAFT_0566 Length = 82 Score = 114 bits (286), Expect = 2e-31 Identities = 57/78 (73%), Positives = 70/78 (89%) Query: 1 MNHTLSILLQNEAGALVRVAGLFAARGYNIDTLTVAATHDPAVSRLTLSLQCDEAALGQI 60 M HTLSILLQNEAGALVRVAGLF+ARG+NID+LTVAAT DPAVS+LTL + + A+ Q+ Sbjct: 1 MKHTLSILLQNEAGALVRVAGLFSARGFNIDSLTVAATQDPAVSQLTLVMHGADEAVDQL 60 Query: 61 LQQTRKLVDVLQVAHPAA 78 ++QTRKLVDV++V+HPAA Sbjct: 61 IKQTRKLVDVIEVSHPAA 78 Lambda K H 0.321 0.130 0.356 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 53 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 82 Length of database: 82 Length adjustment: 8 Effective length of query: 74 Effective length of database: 74 Effective search space: 5476 Effective search space used: 5476 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 38 (20.5 bits) S2: 38 (19.2 bits)
Align candidate N515DRAFT_0566 N515DRAFT_0566 (acetolactate synthase, small subunit)
to HMM TIGR00119 (ilvN: acetolactate synthase, small subunit (EC 2.2.1.6))
../bin/blast/fastacmd -i /tmp/list.28526.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.28526.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.