Align Probable aspartate/prephenate aminotransferase; AspAT / PAT; EC 2.6.1.1; EC 2.6.1.79; Transaminase A (uncharacterized)
to candidate HSERO_RS12800 HSERO_RS12800 aspartate aminotransferase
Query= curated2:Q4UND3 (409 letters) >FitnessBrowser__HerbieS:HSERO_RS12800 Length = 431 Score = 157 bits (397), Expect = 6e-43 Identities = 116/379 (30%), Positives = 199/379 (52%), Gaps = 29/379 (7%) Query: 23 TLELKKA----GVDIIALGAGEPDFDTPDNIKEAAIKAIKDGFTK-YTNVEGMPLLKQAI 77 T ELK A G DII + G PD TP +I E ++ + T Y++ +G+P L++AI Sbjct: 55 TAELKMAARRRGEDIIDMSMGNPDGATPPHIVEKLVEVAQRPDTHGYSSSKGIPRLRRAI 114 Query: 78 KDKFKRENNIDYELD-EIIVSTGGKQVIYNLFMASLDKGDKVIIPAPYWVS--YPDMVAL 134 ++ +D++ D E IV+ G K+ + +L +A+LDKGD V++P P + Y ++A Sbjct: 115 AHWYRSRYEVDFDPDSEAIVTIGSKEGLAHLMLATLDKGDTVLVPNPSYPIHIYGAVIAG 174 Query: 135 STGTPVFVNCGIENNFKLSAEALERSITD---KTKWLIINSPSNPTGASYNFEELENIAK 191 + V ++ G++ + LER++ + K K +I+ PSNPT E E + K Sbjct: 175 ANIRSVRMSPGVD-----FFDELERAVRESYPKPKMMILGFPSNPTAQCVELEFFERVVK 229 Query: 192 VLRKYPHVNVMSDDIYEHITFDDFKFYTLAQIAPDLKERIFTVNGVSKAYSMTGWRIGYG 251 + R++ + V+ D Y ITFD +K ++ Q+ P +E +SK+Y+M GWRIG+ Sbjct: 230 LAREH-QILVVHDLAYADITFDGWKAPSIMQV-PGAREVAVEFFTLSKSYNMAGWRIGFM 287 Query: 252 VGSKALIKAMTIIQSQSTSNPCSISQMAAIESLNGPQDYIKPNALNFQKKRDLALSILKR 311 VG+ L+ A+ I+S + Q+AAI +L G Q ++ N++++R++ + L Sbjct: 288 VGNARLVAALARIKSYHDYGSFTPVQVAAIAALEGDQSCVEEIRANYERRRNVLVKGLHE 347 Query: 312 VKYFECYKPEGAFYLFVKCDKIFGHKTKSGKIIANSNDFAEYLLEEAKVAVVPGIAFGLE 371 + P+ + Y++ + + + S +FA LLE+AKV V PGI FG Sbjct: 348 AGWM-VDVPKASMYIWARIPEPYRQ--------FGSLEFARILLEQAKVCVSPGIGFGEY 398 Query: 372 G--YFRISYATSMEELEEA 388 G Y R + + + +A Sbjct: 399 GDEYVRFALIENESRIRQA 417 Lambda K H 0.317 0.135 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 368 Number of extensions: 16 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 409 Length of database: 431 Length adjustment: 32 Effective length of query: 377 Effective length of database: 399 Effective search space: 150423 Effective search space used: 150423 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory