Align phosphoribosylanthranilate isomerase (EC 5.3.1.24) (characterized)
to candidate HSERO_RS20320 HSERO_RS20320 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
Query= BRENDA::P16250 (240 letters) >FitnessBrowser__HerbieS:HSERO_RS20320 Length = 265 Score = 140 bits (352), Expect = 3e-38 Identities = 80/234 (34%), Positives = 127/234 (54%), Gaps = 13/234 (5%) Query: 6 LLPAVDVRDGQAVRLVHGESGTETSYGS-PLEAALAWQRSGAEWLHLVDLDAAF-GTGDN 63 L+PA+D++DG VRL G+ T + P E AL W + GA LHLVDL+ AF G N Sbjct: 3 LIPAIDLKDGHCVRLKQGDMDQATVFSEDPAEMALHWLKQGARRLHLVDLNGAFAGKPKN 62 Query: 64 RALIAEVAQAM----------DIKVELSGGIRDDDTLAAALATGCTRVNLGTAALETPEW 113 A + + +A+ +I V+L GGIRD DT+ L G + + +GTAA++ P + Sbjct: 63 EAAVKAILKAVASFAEENEVEEIPVQLGGGIRDLDTIERYLDDGLSYIIIGTAAVKNPGF 122 Query: 114 VAKVIAEHGDKIAVGLDVRGTTLRGRGWTR-DGGDLYETLDRLNKEGCARYVVTDIAKDG 172 + + +I VGLD + + GW++ G ++ + + GC V TDI +DG Sbjct: 123 LHDACSAFPGQIIVGLDAKDGKVATDGWSKLSGHEVVDLAQKFEGYGCEAIVYTDIGRDG 182 Query: 173 TLQGPNLELLKNVCAATDRPVVASGGVSSLDDLRAIAGLVPAGVEGAIVGKALY 226 + G N+E + A P++ASGGV ++ D+ A+ + G+E I G+++Y Sbjct: 183 MMGGVNIEATVRLAQAVTIPIIASGGVHNVGDVEALCRVEDEGIEAVICGRSIY 236 Lambda K H 0.315 0.133 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 174 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 265 Length adjustment: 24 Effective length of query: 216 Effective length of database: 241 Effective search space: 52056 Effective search space used: 52056 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory