GapMind for Amino acid biosynthesis

 

Protein BWI76_RS04680 in Klebsiella michiganensis M5al

Annotation: FitnessBrowser__Koxy:BWI76_RS04680

Length: 523 amino acids

Source: Koxy in FitnessBrowser

Candidate for 3 steps in Amino acid biosynthesis

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-leucine biosynthesis leuA hi 2-isopropylmalate synthase; Alpha-IPM synthase; Alpha-isopropylmalate synthase; EC 2.3.3.13 (characterized) 95% 100% 986.9
L-leucine biosynthesis leuA hi leuA: 2-isopropylmalate synthase (EC 2.3.3.13) (TIGR00973) 100% 846.5
L-lysine biosynthesis hcs med homocitrate synthase (EC 2.3.3.14) (characterized) 43% 95% 369.4 2-isopropylmalate synthase; Alpha-IPM synthase; Alpha-isopropylmalate synthase; EC 2.3.3.13 95% 986.9
L-isoleucine biosynthesis cimA lo Putative (R)-citramalate synthase CimA; EC 2.3.3.21 (uncharacterized) 37% 97% 308.5 2-isopropylmalate synthase; Alpha-IPM synthase; Alpha-isopropylmalate synthase; EC 2.3.3.13 95% 986.9

Sequence Analysis Tools

View BWI76_RS04680 at FitnessBrowser

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSQQVIIFDTTLRDGEQALQASLSVKEKLQIAMALERMGVDVMEVGFPVSSPGDFESVQT
IARTIKNSRVCALARCVEKDIDVAAESLKVAEAFRIHTFIATSPMHIATKLRSNLDEVIE
RAIYMVKRARNYTDDVEFSCEDAGRTPIADLARVVEAAINAGATTINIPDTVGYTMPFEF
ANIITGLYEHVPNIDKAIISVHTHDDLGIAVGNALAAVHAGARQVEGAMNGIGERAGNCS
LEEVIMAIKVRKDIMNVHTRINHQEIWRTSQTVSQICNMPIPANKAIVGTGAFAHSSGIH
QDGVLKNRENYEIMTPESIGLNQVQLNLTSRSGRAAVKHRMEEMGYKETDYNMDHLYDAF
LKLADKKGQVFDYDLEALAFINKQQEEPEHFRLDYFSVQSGSSDIATASVKLACGDETKA
EAANGNGPVDAIYQAINRITGYEIELVKYDLNAKGQGKDALGQVDIVANYNGRRFHGVGL
ATDIVESSAKAMVHVLNNIWRAAEVEKELQRKAQNKENNKETV

This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory