Align Shikimate kinase; SK; EC 2.7.1.71 (uncharacterized)
to candidate GFF2734 HP15_2678 shikimate kinase
Query= curated2:A0QI60 (176 letters) >FitnessBrowser__Marino:GFF2734 Length = 174 Score = 98.2 bits (243), Expect = 7e-26 Identities = 66/162 (40%), Positives = 86/162 (53%), Gaps = 4/162 (2%) Query: 6 VLIGLPGSGKSTIGRRLAKALGVGFLDTDAAIEQRTGRPIAEIFATDGEREFRRIEEEVV 65 VLIG+PGSGKST+G LAK LG+GF+DTD I++ R + I DG RRIEE+V+ Sbjct: 11 VLIGMPGSGKSTVGVLLAKHLGLGFVDTDLLIQEEADRTLQAIVDQDGYEALRRIEEQVL 70 Query: 66 RAALTEHDGVLSLGGGAVTSPGVREALAGH-TVVYLEISATEGVRRTGGNTVRPLLAGPD 124 H V+S GG AV S E L + TVV+L+I + R G + +R + PD Sbjct: 71 LKLDVRHK-VISTGGSAVYSARAMEHLKSNGTVVFLDIPLELVIERIGDHCMRGISRRPD 129 Query: 125 RAEKYRALLAERSPLYRRAATIRVDTNRRNPGAVVRYIVSRL 166 + AL ER LY R A + V N V +V L Sbjct: 130 --QSLDALFEERFELYSRYADVTVKGEGLNQDQVCEAVVESL 169 Lambda K H 0.318 0.136 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 81 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 176 Length of database: 174 Length adjustment: 19 Effective length of query: 157 Effective length of database: 155 Effective search space: 24335 Effective search space used: 24335 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory