Align arogenate dehydratase (EC 4.2.1.91) (characterized)
to candidate GFF1395 HP15_1362 chorismate mutase / prephenate dehydratase
Query= BRENDA::Q9SSE7 (381 letters) >FitnessBrowser__Marino:GFF1395 Length = 365 Score = 155 bits (392), Expect = 2e-42 Identities = 100/281 (35%), Positives = 154/281 (54%), Gaps = 16/281 (5%) Query: 99 VRVAYQGVRGAYSESAAEKAYPNCE-AVPCEEFDTAFEAVERWLVDRAVLPIENSLGGSI 157 + +A+ G G ++++AA K + + +VP D F VE V+P+ENS G I Sbjct: 95 MHIAFLGPIGTFTQAAALKHFGHSVVSVPLPAIDAVFREVESGAAHYGVVPVENSTEGMI 154 Query: 158 HRNYDLLLRHNLHIVGEVKLAVRHCLLANHGVNIEDLRRVLSHPQALAQCENTLT--KLG 215 + D+ + L I GEV+L + H LL + +++ R+ SH Q+ AQC L + G Sbjct: 155 NHTLDMFMSSPLKICGEVQLRIHHHLLVSPKHGDQEITRIYSHQQSFAQCRQWLDTHRYG 214 Query: 216 LVREAVDDTAGAAKQIAFENLNDAAAVASEKAAKIYGLNIVAKDIQDDCDNVTRFLMLAR 275 + R V A AA++ A E AA+A + AA++YGL +A I+D DN TRFL++ R Sbjct: 215 IERVTVSSNAEAARRAAEE--PGTAAIAGDMAAELYGLQKLANSIEDRPDNTTRFLIIGR 272 Query: 276 EPIIPGTNRLFKTSIVFSLEEGPGVLFKALAVFALRQINLTKIESRPLRKHPLRASGGLK 335 E +P + K+SI+ S+ PG L++ L F ++LT+IE+RP SG Sbjct: 273 EE-VPASGH-DKSSILVSMRNKPGALYQLLEPFHRHGLSLTRIETRP------SPSG--- 321 Query: 336 YFDYLFYVDFEASMADEVAQNALRHLEEFATFLRVLGSYPV 376 + Y+FY+DFE M DE + L ++E A L+ LGSYP+ Sbjct: 322 TWAYVFYIDFEGHMEDEQVRKVLAEVDEEAVELKRLGSYPI 362 Lambda K H 0.319 0.134 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 277 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 365 Length adjustment: 30 Effective length of query: 351 Effective length of database: 335 Effective search space: 117585 Effective search space used: 117585 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory