Align Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 (characterized)
to candidate GFF1395 HP15_1362 chorismate mutase / prephenate dehydratase
Query= SwissProt::P27603 (365 letters) >FitnessBrowser__Marino:GFF1395 Length = 365 Score = 464 bits (1195), Expect = e-135 Identities = 235/363 (64%), Positives = 280/363 (77%), Gaps = 1/363 (0%) Query: 3 EADQLKALRVRIDSLDERILDLISERARCAQEVARVKTASWPKAEEAVFYRPEREAWVLK 62 E +L LR ID LD++I++LIS RA CAQEVA VK + P ++ FYRPEREA VL+ Sbjct: 4 EQVRLGELRDEIDQLDQKIMELISARAACAQEVAHVKMTANP-GQDVFFYRPEREAQVLR 62 Query: 63 HIMELNKGPLDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHSVISK 122 I E N GPL EEMARLFREIMS+CLALE+P+ +A+LGP GTF+QAAALKHFGHSV+S Sbjct: 63 RIKEQNPGPLSGEEMARLFREIMSACLALEKPMHIAFLGPIGTFTQAAALKHFGHSVVSV 122 Query: 123 PMAAIDEVFREVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHLLV 182 P+ AID VFREV +GA ++GVVPVENSTEG +NHTLD F+ + ICGEV+LRIHHHLLV Sbjct: 123 PLPAIDAVFREVESGAAHYGVVPVENSTEGMINHTLDMFMSSPLKICGEVQLRIHHHLLV 182 Query: 183 GETTKTDRITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIAGD 242 ITRIYSH QS AQCR+WLD H +ERV VSSNA+AA+R E +AAIAGD Sbjct: 183 SPKHGDQEITRIYSHQQSFAQCRQWLDTHRYGIERVTVSSNAEAARRAAEEPGTAAIAGD 242 Query: 243 MAAQLYGLSKLAEKIEDRPVNSTRFLIIGSQEVPPTGDDKTSIIVSMRNKPGALHELLMP 302 MAA+LYGL KLA IEDRP N+TRFLIIG +EVP +G DK+SI+VSMRNKPGAL++LL P Sbjct: 243 MAAELYGLQKLANSIEDRPDNTTRFLIIGREEVPASGHDKSSILVSMRNKPGALYQLLEP 302 Query: 303 FHSNGIDLTRIETRPSRSGKWTYVFFIDCMGHHQDPLIKNVLEKIGHEAVALKVLGSYPK 362 FH +G+ LTRIETRPS SG W YVF+ID GH +D ++ VL ++ EAV LK LGSYP Sbjct: 303 FHRHGLSLTRIETRPSPSGTWAYVFYIDFEGHMEDEQVRKVLAEVDEEAVELKRLGSYPI 362 Query: 363 AVL 365 VL Sbjct: 363 GVL 365 Lambda K H 0.319 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 401 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 365 Length adjustment: 30 Effective length of query: 335 Effective length of database: 335 Effective search space: 112225 Effective search space used: 112225 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate GFF1395 HP15_1362 (chorismate mutase / prephenate dehydratase)
to HMM TIGR01807 (pheA: chorismate mutase (EC 5.4.99.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01807.hmm # target sequence database: /tmp/gapView.3087601.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01807 [M=76] Accession: TIGR01807 Description: CM_P2: chorismate mutase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-33 100.1 0.3 1.3e-32 98.2 0.2 2.0 2 FitnessBrowser__Marino:GFF1395 Domain annotation for each sequence (and alignments): >> FitnessBrowser__Marino:GFF1395 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 98.2 0.2 1.3e-32 1.3e-32 1 76 [] 8 85 .. 8 85 .. 0.95 2 ? -2.3 0.0 0.31 0.31 67 75 .. 126 134 .. 122 134 .. 0.83 Alignments for each domain: == domain 1 score: 98.2 bits; conditional E-value: 1.3e-32 TIGR01807 1 LkelRnkiDaiDdrildLlseRaklakavgelKkks..aseaviYRPeREaavlrrlkelnkGpLdqeavarifrEim 76 L elR++iD +D++i++L+s Ra +a++v+++K ++ ++ ++YRPeREa+vlrr+ke+n+GpL e++ar+frEim FitnessBrowser__Marino:GFF1395 8 LGELRDEIDQLDQKIMELISARAACAQEVAHVKMTAnpGQDVFFYRPEREAQVLRRIKEQNPGPLSGEEMARLFREIM 85 679******************************9976567789**********************************9 PP == domain 2 score: -2.3 bits; conditional E-value: 0.31 TIGR01807 67 avarifrEi 75 a++++frE+ FitnessBrowser__Marino:GFF1395 126 AIDAVFREV 134 79999**98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (76 nodes) Target sequences: 1 (365 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 17.02 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory