Align Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Asp/Glu-ADT subunit C; EC 6.3.5.- (uncharacterized)
to candidate 8502126 DvMF_2837 glutamyl-tRNA(Gln) amidotransferase, C subunit (RefSeq)
Query= curated2:Q72DX0 (94 letters) >FitnessBrowser__Miya:8502126 Length = 95 Score = 124 bits (311), Expect = 3e-34 Identities = 61/92 (66%), Positives = 72/92 (78%) Query: 3 ISKEQVATIARLARLDLDEARLERFAGQFGDILDYMDMLGAVDTTDVEPLYSPSEHGTVL 62 IS +QVA IARLARL DEA+L FA QFGDIL YM+ML +DTT VEPLYSP +H T L Sbjct: 4 ISTDQVAAIARLARLAPDEAQLATFARQFGDILGYMEMLNGLDTTGVEPLYSPVQHATAL 63 Query: 63 RADEVHTHCTREELLANAPESDGQFFVVPRIV 94 R+DE CTRE++L NAPE+D +FF+VPRIV Sbjct: 64 RSDETAPRCTREDVLRNAPEADSEFFIVPRIV 95 Lambda K H 0.320 0.136 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 52 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 94 Length of database: 95 Length adjustment: 10 Effective length of query: 84 Effective length of database: 85 Effective search space: 7140 Effective search space used: 7140 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.9 bits) S2: 39 (19.6 bits)
Align candidate 8502126 DvMF_2837 (glutamyl-tRNA(Gln) amidotransferase, C subunit (RefSeq))
to HMM TIGR00135 (gatC: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit (EC 6.3.5.-))
../bin/blast/fastacmd -i /tmp/list.23803.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.23803.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.