Align acetolactate synthase (subunit 1/2) (EC 2.2.1.6) (characterized)
to candidate 8499377 DvMF_0154 acetolactate synthase 3 regulatory subunit (RefSeq)
Query= BRENDA::P9WKJ3 (168 letters) >FitnessBrowser__Miya:8499377 Length = 163 Score = 157 bits (396), Expect = 1e-43 Identities = 82/154 (53%), Positives = 112/154 (72%) Query: 6 HTLSVLVEDKPGVLARVAALFSRRGFNIESLAVGATECKDRSRMTIVVSAEDTPLEQITK 65 H LSVLVE++PGVL+RVA LFS RGFNIESL V T + S MTI S E+ +EQI K Sbjct: 3 HVLSVLVENEPGVLSRVAGLFSGRGFNIESLNVAPTLEEGVSLMTITTSGEEQIIEQIVK 62 Query: 66 QLNKLINVIKIVEQDDEHSVSRELALIKVQADAGSRSQVIEAVNLFRANVIDVSPESLTV 125 QL KL+ VIK+V+ D +V RE+ ++KVQAD R++V+ ++FR V+DVS LT+ Sbjct: 63 QLRKLVTVIKVVDFIDVSAVEREMVMVKVQADDARRAEVLRIADIFRCKVVDVSLNDLTL 122 Query: 126 EATGNRGKLEALLRVLEPFGIREIAQSGMVSLSR 159 EATG+ GK++A+L +L FGI+EIA++G V++ R Sbjct: 123 EATGDHGKIQAILSLLARFGIKEIARTGTVAMRR 156 Lambda K H 0.315 0.131 0.347 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 95 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 168 Length of database: 163 Length adjustment: 18 Effective length of query: 150 Effective length of database: 145 Effective search space: 21750 Effective search space used: 21750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 43 (21.2 bits)
Align candidate 8499377 DvMF_0154 (acetolactate synthase 3 regulatory subunit (RefSeq))
to HMM TIGR00119 (ilvN: acetolactate synthase, small subunit (EC 2.2.1.6))
../bin/blast/fastacmd -i /tmp/list.5209.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.5209.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.