Align Probable acetolactate synthase small subunit; EC 2.2.1.6; Acetohydroxy-acid synthase small subunit; AHAS; ALS (uncharacterized)
to candidate 8501909 DvMF_2624 acetolactate synthase, small subunit (RefSeq)
Query= curated2:O28555 (159 letters) >FitnessBrowser__Miya:8501909 Length = 160 Score = 118 bits (296), Expect = 4e-32 Identities = 58/158 (36%), Positives = 99/158 (62%), Gaps = 1/158 (0%) Query: 1 MKHTIAVLVENKPGVLARVAGLFRRRGFNIESLTVGTTERDDLSRMTIVVEGDDKVVEQV 60 MKHT++VLV+N+ G +A +FRRRG + S++ TE D+SR+ + VE + +E + Sbjct: 1 MKHTLSVLVKNRAGAVAEATDVFRRRGISFRSISCAETEDFDVSRLVLTVEDHEAELESI 60 Query: 61 IKQLNKLIETIKVSEITESS-VERELCLIRVHAPPEKRGEIVELTNIFRARIVDVSRDSF 119 ++L V +++ V+REL L++V E +I+++ +FRA ++ + +++ Sbjct: 61 AEELRAQDVVAMVEDLSRRDFVDRELVLVKVDVTRETTTQIMQVCEVFRASVIGMGQETM 120 Query: 120 IIEVTGDEDKVSAFIDLMRQYGIKELARTGKVAMVRGN 157 +E+TGD KV FI ++R +GI+ LARTG VAM RG+ Sbjct: 121 TVEMTGDTQKVDGFIRMLRPFGIRSLARTGVVAMKRGD 158 Lambda K H 0.319 0.137 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 81 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 159 Length of database: 160 Length adjustment: 17 Effective length of query: 142 Effective length of database: 143 Effective search space: 20306 Effective search space used: 20306 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 43 (21.2 bits)
Align candidate 8501909 DvMF_2624 (acetolactate synthase, small subunit (RefSeq))
to HMM TIGR00119 (ilvN: acetolactate synthase, small subunit (EC 2.2.1.6))
../bin/blast/fastacmd -i /tmp/list.22975.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.22975.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.