Align Diaminopimelate epimerase; DAP epimerase; EC 5.1.1.7; PLP-independent amino acid racemase (uncharacterized)
to candidate 8499796 DvMF_0561 diaminopimelate epimerase (RefSeq)
Query= curated2:O67693 (279 letters) >FitnessBrowser__Miya:8499796 Length = 282 Score = 201 bits (512), Expect = 1e-56 Identities = 125/279 (44%), Positives = 160/279 (57%), Gaps = 19/279 (6%) Query: 5 KLQGSGNDFVVIDDRDEKLESFLKERGVSKEDFVRKVCAFHTGVGADGLILI-KNPDNPE 63 KL G GNDFV ID+R L + D+ R VC GVGADGL+ + + P + E Sbjct: 12 KLHGCGNDFVFIDNRALGLPV------AAMPDWARSVCRRAFGVGADGLVFLDETPKDRE 65 Query: 64 NDFKWEFFNSDGSVAEMCGNGSRCAVRFAYERGIVGNKVRFETLAGVIKAEVYENGRKVK 123 D+ W F+N+DGS AEMCGN SRCA A E G G K F T AG+I+AE K Sbjct: 66 GDYIWHFYNADGSRAEMCGNASRCAALLAVELGFAGPKHVFGTDAGLIRAEADVAAGMAK 125 Query: 124 VQLTPPSKPEEKTLTVD-----GEEVIGVFINTGVPHFVVPVEDVEKVNVIKLGRAIRFH 178 V+LTPP + TL ++ G +++ F+NTGVPH VV D V+V LG A+R H Sbjct: 126 VELTPP---RDLTLGIELDLGEGRDMVH-FVNTGVPHAVVFKRDASTVDVRTLGAALRRH 181 Query: 179 EEFQPKGTNVNFVQPVSEDTIKVRTYERGVESETLACGTGATACAIVSYLKGLVKKKPVN 238 F P GTN NF Q + I +RT+ERGVE ET ACGTGA A A +++ GL + VN Sbjct: 182 AHFAPAGTNANFAQVIDRRNIHLRTFERGVEDETYACGTGAAAGAFIAHALGLA-ESTVN 240 Query: 239 VLTRSGEVLTIDFSEDLKEVFLTGSVYKVFEGRLSEEVL 277 V + GE+L I S + VFL+G +VF G + E L Sbjct: 241 VRSSGGEILGI--SIEGGSVFLSGKAVRVFSGEMFLEGL 277 Lambda K H 0.317 0.138 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 205 Number of extensions: 7 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 279 Length of database: 282 Length adjustment: 26 Effective length of query: 253 Effective length of database: 256 Effective search space: 64768 Effective search space used: 64768 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
Align candidate 8499796 DvMF_0561 (diaminopimelate epimerase (RefSeq))
to HMM TIGR00652 (dapF: diaminopimelate epimerase (EC 5.1.1.7))
../bin/blast/fastacmd -i /tmp/list.24655.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.24655.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.