Align isochorismate lyase (EC 4.2.99.21); isochorismate synthase (EC 5.4.4.2) (characterized)
to candidate Dsui_0001 Dsui_0001 aminodeoxychorismate synthase, component I
Query= BRENDA::P9WFX1 (450 letters) >FitnessBrowser__PS:Dsui_0001 Length = 606 Score = 96.7 bits (239), Expect = 2e-24 Identities = 81/251 (32%), Positives = 121/251 (48%), Gaps = 7/251 (2%) Query: 196 DEIAAGRYHKVILSRCVEVPFAIDFPLTY--RLGRRHNTPVRSFLLQLGGIRALGYSPEL 253 D IAAG ++V + + A PL RL +R TP+ +L R L SPEL Sbjct: 148 DYIAAGDCYQVNFTFPLHFQ-AYGHPLALYARLRQRQPTPLGGLVLTAER-RILSLSPEL 205 Query: 254 VTAVRADGVVITEPLAGTRALGRGPAIDRLARDDLESNSKEIVEHAISVRSSLEEITDIA 313 A R D + T P+ GT G A D R L +++K+ E+ + V ++ +A Sbjct: 206 FVARRGD-TLRTRPMKGTAPRGADEAGDAANRAALAASAKDRAENLMIVDLLRNDLGRLA 264 Query: 314 EPGSAAVIDFMTVRERGSVQHLGSTIRARLDPSSDRMAALEALFPAVTASGIPKAAGVEA 373 + GS V + + SV + ST+ AR P L ALFP + +G PK +E Sbjct: 265 QTGSVRVEELFAIETYPSVFQMTSTVSARA-PGVGPGETLAALFPCGSITGAPKLRAMEI 323 Query: 374 IFRLDECPRGLYSGAVVMLSADGGLDAALTLRA-AYQVGGRTWLRAGAGIIEESEPEREF 432 I L+ PRGLY+G++ +L+ DG + +R+ GR + G+GI+ +SEP E+ Sbjct: 324 IEELEVGPRGLYTGSLGLLAPDGDFCLNVAIRSLELGADGRGVMGVGSGIVTDSEPAAEY 383 Query: 433 EETCEKLSTLT 443 E K LT Sbjct: 384 RECLLKARFLT 394 Lambda K H 0.319 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 634 Number of extensions: 47 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 450 Length of database: 606 Length adjustment: 35 Effective length of query: 415 Effective length of database: 571 Effective search space: 236965 Effective search space used: 236965 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory